SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma16g19320): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma16g19320): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma16g19320

Feature Type:gene_model
Chromosome:Gm16
Start:21290621
stop:21292471
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G08950AT Annotation by Michelle Graham. TAIR10: electron transport SCO1/SenC family protein | chr3:2727285-2729289 FORWARD LENGTH=334 SoyBaseE_val: 2.00E-67ISS
GO:0006626GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to mitochondrion SoyBaseN/AISS
GO:0006825GO-bp Annotation by Michelle Graham. GO Biological Process: copper ion transport SoyBaseN/AISS
GO:0006878GO-bp Annotation by Michelle Graham. GO Biological Process: cellular copper ion homeostasis SoyBaseN/AISS
GO:0008535GO-bp Annotation by Michelle Graham. GO Biological Process: respiratory chain complex IV assembly SoyBaseN/AISS
GO:0009790GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development SoyBaseN/AISS
GO:0019243GO-bp Annotation by Michelle Graham. GO Biological Process: methylglyoxal catabolic process to D-lactate SoyBaseN/AISS
GO:0033617GO-bp Annotation by Michelle Graham. GO Biological Process: mitochondrial respiratory chain complex IV assembly SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005507GO-mf Annotation by Michelle Graham. GO Molecular Function: copper ion binding SoyBaseN/AISS
PTHR12151Panther SCO1/SENC JGI ISS
PF02630PFAM SCO1/SenC JGI ISS
UniRef100_B9T1I6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Protein sco1, putative n=1 Tax=Ricinus communis RepID=B9T1I6_RICCO SoyBaseE_val: 1.00E-70ISS
UniRef100_I1MMP5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1MMP5_SOYBN SoyBaseE_val: 5.00E-127ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma16g19320 not represented in the dataset

Glyma16g19320 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma07g18460 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Glyma18g43300 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma16g19320.1   sequence type=CDS   gene model=Glyma16g19320   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GCACAAGAACTTGACAAGAACTCAAACAGATTTTTTTTTGACACAAAGTCTGAAAGACACAAGAAACAAGAACAAGAACGTGACAAGAACAAGAACAAGAACGCAAATAACAGAACACAAGATGCAAACAAGAACGAAACAAGATGGATACGTACTAATACGGAGGCTGTTAAGCAGGGACCTTCTACAGGAAAAGCTGCAATTGGGGGTCCATTTCGCGTTATCAACCATCACGGAAAACATGTAACTGAAAAGGATTTCATGGGAAAGTGGACTTTGTTATATTTTGGCTTTACTCACTGCCCGAATATCTGTCCAGAGGAACTACAGAAGTTAGCAGCTGCTGTTGATAAAATAAAGGAGAAAGCTGGAATTGAAACTGTTCCGGTTTTTATCTCTATTGATCCTGAGAGGGATATTGTTGAACAAGTCGGTGAATATGTCAAAGAATTTCATCCGAAGTTAATTGGATTAACTGGTAGCCCCGATGAGGTCAAGAATGTTGCTCGTGCATATCGCGTTTAT

>Glyma16g19320.1   sequence type=predicted peptide   gene model=Glyma16g19320   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AQELDKNSNRFFFDTKSERHKKQEQERDKNKNKNANNRTQDANKNETRWIRTNTEAVKQGPSTGKAAIGGPFRVINHHGKHVTEKDFMGKWTLLYFGFTHCPNICPEELQKLAAAVDKIKEKAGIETVPVFISIDPERDIVEQVGEYVKEFHPKLIGLTGSPDEVKNVARAYRVY







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo