Glyma16g19320 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma16g19320

Feature Type:	gene_model
Chromosome:	Gm16
Start:	21290621
stop:	21292471
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma16g19320

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G08950	AT	Annotation by Michelle Graham. TAIR10: electron transport SCO1/SenC family protein \| chr3:2727285-2729289 FORWARD LENGTH=334	SoyBase	E_val: 2.00E-67	ISS
GO:0006626	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein targeting to mitochondrion	SoyBase	N/A	ISS
GO:0006825	GO-bp	Annotation by Michelle Graham. GO Biological Process: copper ion transport	SoyBase	N/A	ISS
GO:0006878	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular copper ion homeostasis	SoyBase	N/A	ISS
GO:0008535	GO-bp	Annotation by Michelle Graham. GO Biological Process: respiratory chain complex IV assembly	SoyBase	N/A	ISS
GO:0009790	GO-bp	Annotation by Michelle Graham. GO Biological Process: embryo development	SoyBase	N/A	ISS
GO:0019243	GO-bp	Annotation by Michelle Graham. GO Biological Process: methylglyoxal catabolic process to D-lactate	SoyBase	N/A	ISS
GO:0033617	GO-bp	Annotation by Michelle Graham. GO Biological Process: mitochondrial respiratory chain complex IV assembly	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0005507	GO-mf	Annotation by Michelle Graham. GO Molecular Function: copper ion binding	SoyBase	N/A	ISS
PTHR12151	Panther	SCO1/SENC	JGI		ISS
PF02630	PFAM	SCO1/SenC	JGI		ISS
UniRef100_B9T1I6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Protein sco1, putative n=1 Tax=Ricinus communis RepID=B9T1I6_RICCO	SoyBase	E_val: 1.00E-70	ISS
UniRef100_I1MMP5	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1MMP5_SOYBN	SoyBase	E_val: 5.00E-127	ISS

Expression Patterns of Glyma16g19320

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma16g19320

Paralog	Evidence	Comments
Glyma07g18460	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Glyma18g43300	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma16g19320 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma16g19320

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma16g19320

Limit To All Plant Sequences

>Glyma16g19320.1   sequence type=CDS   gene model=Glyma16g19320   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GCACAAGAACTTGACAAGAACTCAAACAGATTTTTTTTTGACACAAAGTCTGAAAGACACAAGAAACAAGAACAAGAACGTGACAAGAACAAGAACAAGAACGCAAATAACAGAACACAAGATGCAAACAAGAACGAAACAAGATGGATACGTACTAATACGGAGGCTGTTAAGCAGGGACCTTCTACAGGAAAAGCTGCAATTGGGGGTCCATTTCGCGTTATCAACCATCACGGAAAACATGTAACTGAAAAGGATTTCATGGGAAAGTGGACTTTGTTATATTTTGGCTTTACTCACTGCCCGAATATCTGTCCAGAGGAACTACAGAAGTTAGCAGCTGCTGTTGATAAAATAAAGGAGAAAGCTGGAATTGAAACTGTTCCGGTTTTTATCTCTATTGATCCTGAGAGGGATATTGTTGAACAAGTCGGTGAATATGTCAAAGAATTTCATCCGAAGTTAATTGGATTAACTGGTAGCCCCGATGAGGTCAAGAATGTTGCTCGTGCATATCGCGTTTAT

Predicted protein sequences of Glyma16g19320

Limit To All Plant Sequences

>Glyma16g19320.1   sequence type=predicted peptide   gene model=Glyma16g19320   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AQELDKNSNRFFFDTKSERHKKQEQERDKNKNKNANNRTQDANKNETRWIRTNTEAVKQGPSTGKAAIGGPFRVINHHGKHVTEKDFMGKWTLLYFGFTHCPNICPEELQKLAAAVDKIKEKAGIETVPVFISIDPERDIVEQVGEYVKEFHPKLIGLTGSPDEVKNVARAYRVY

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain