|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT3G16890 | AT | Annotation by Michelle Graham. TAIR10: pentatricopeptide (PPR) domain protein 40 | chr3:5768401-5770380 REVERSE LENGTH=659 | SoyBase | E_val: 1.00E-18 | ISS |
GO:0006979 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to oxidative stress | SoyBase | N/A | ISS |
GO:0009651 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to salt stress | SoyBase | N/A | ISS |
GO:0009737 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus | SoyBase | N/A | ISS |
GO:0042775 | GO-bp | Annotation by Michelle Graham. GO Biological Process: mitochondrial ATP synthesis coupled electron transport | SoyBase | N/A | ISS |
GO:0005739 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion | SoyBase | N/A | ISS |
PTHR24015 | Panther | FAMILY NOT NAMED | JGI | ISS | |
PF01535 | PFAM | PPR repeat | JGI | ISS | |
UniRef100_B9RZM2 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Pentatricopeptide repeat-containing protein, putative n=1 Tax=Ricinus communis RepID=B9RZM2_RICCO | SoyBase | E_val: 5.00E-23 | ISS |
UniRef100_I1KWZ9 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1KWZ9_SOYBN | SoyBase | E_val: 5.00E-32 | ISS |
Glyma16g18491 not represented in the dataset |
Glyma16g18491 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma16g18491.1 sequence type=CDS gene model=Glyma16g18491 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGCTTTTAGAAAATGGACTTAAACCTGATATCTTCACTTTTAGCTCAATAATTGATGGACTCTGTCGAATAAAGAGGACTGAGGAAGCTTTTGAATGCTTTACTGAGATGATTGAGTGGGGCATCAATCCAAATGCTGCCATTTACAATATCTTGATTCGATCTTTATCCACCATCAGGGATGTTGCAAGGACTACGTTGAAGCGGCTTAAAACATCATAG
>Glyma16g18491.1 sequence type=predicted peptide gene model=Glyma16g18491 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MLLENGLKPDIFTFSSIIDGLCRIKRTEEAFECFTEMIEWGINPNAAIYNILIRSLSTIRDVARTTLKRLKTS*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||