|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G71790 | AT | Annotation by Michelle Graham. TAIR10: Subunits of heterodimeric actin filament capping protein Capz superfamily | chr1:26996869-26998785 FORWARD LENGTH=256 | SoyBase | E_val: 9.00E-18 | ISS |
| GO:0007015 | GO-bp | Annotation by Michelle Graham. GO Biological Process: actin filament organization | SoyBase | N/A | ISS |
| GO:0009408 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to heat | SoyBase | N/A | ISS |
| GO:0030036 | GO-bp | Annotation by Michelle Graham. GO Biological Process: actin cytoskeleton organization | SoyBase | N/A | ISS |
| GO:0051693 | GO-bp | Annotation by Michelle Graham. GO Biological Process: actin filament capping | SoyBase | N/A | ISS |
| GO:0005737 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm | SoyBase | N/A | ISS |
| GO:0008290 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: F-actin capping protein complex | SoyBase | N/A | ISS |
| GO:0003779 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: actin binding | SoyBase | N/A | ISS |
| PF01115 | PFAM | F-actin capping protein, beta subunit | JGI | ISS | |
| UniRef100_B6TFH2 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: F-actin capping protein beta subunit n=1 Tax=Zea mays RepID=B6TFH2_MAIZE | SoyBase | E_val: 2.00E-15 | ISS |
| UniRef100_I1LDB1 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LDB1_SOYBN | SoyBase | E_val: 2.00E-22 | ISS |
|
Glyma16g18075 not represented in the dataset |
Glyma16g18075 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.16g101900 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma16g18075.1 sequence type=CDS gene model=Glyma16g18075 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGTGGAGGATTCCACCGAAACACGCAGAAACAGCTCTATCTGCACTTTTGAGCCTTATGCCTCATAGCTCCTCCAAGCTCCTCTCTCAAGTTTTGTGCAATGTGGAATGTGACAAGGAGTTCATTTTGTGCGAATACAATAGAGATGTCGACTCTTACAAAGGAAAAGTAAAGGGCCATTTCAACTGCCAAGGAAACACTGGATGCATCCCTTTGGCCGCTACAAAGTGA
>Glyma16g18075.1 sequence type=predicted peptide gene model=Glyma16g18075 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MWRIPPKHAETALSALLSLMPHSSSKLLSQVLCNVECDKEFILCEYNRDVDSYKGKVKGHFNCQGNTGCIPLAATK*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||