SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma16g18045): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma16g18045): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma16g18045

Feature Type:gene_model
Chromosome:Gm16
Start:19724079
stop:19727104
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G54720AT Annotation by Michelle Graham. TAIR10: Peptidase M28 family protein | chr3:20254852-20257815 REVERSE LENGTH=705 SoyBaseE_val: 9.00E-41ISS
GO:0006508GO-bp Annotation by Michelle Graham. GO Biological Process: proteolysis SoyBaseN/AISS
GO:0009640GO-bp Annotation by Michelle Graham. GO Biological Process: photomorphogenesis SoyBaseN/AISS
GO:0009790GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development SoyBaseN/AISS
GO:0009908GO-bp Annotation by Michelle Graham. GO Biological Process: flower development SoyBaseN/AISS
GO:0009910GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of flower development SoyBaseN/AISS
GO:0010305GO-bp Annotation by Michelle Graham. GO Biological Process: leaf vascular tissue pattern formation SoyBaseN/AISS
GO:0048364GO-bp Annotation by Michelle Graham. GO Biological Process: root development SoyBaseN/AISS
GO:0048507GO-bp Annotation by Michelle Graham. GO Biological Process: meristem development SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0004180GO-mf Annotation by Michelle Graham. GO Molecular Function: carboxypeptidase activity SoyBaseN/AISS
GO:0008233GO-mf Annotation by Michelle Graham. GO Molecular Function: peptidase activity SoyBaseN/AISS
GO:0016805GO-mf Annotation by Michelle Graham. GO Molecular Function: dipeptidase activity SoyBaseN/AISS
PTHR10404Panther GLUTAMATE CARBOXYPEPTIDASE JGI ISS
PF04389PFAM Peptidase family M28 JGI ISS
UniRef100_B9SDP7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Transferrin receptor protein, putative n=1 Tax=Ricinus communis RepID=B9SDP7_RICCO SoyBaseE_val: 1.00E-43ISS
UniRef100_I1NAY2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NAY2_SOYBN SoyBaseE_val: 9.00E-49ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma16g18045 not represented in the dataset

Glyma16g18045 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.16g102200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma16g18045.1   sequence type=CDS   gene model=Glyma16g18045   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAACGGTTAAGCTAAAGCTCGATAGTGTTTGCACGAGAACAGCTGCACTACTCGACATTGCTCGTCGATTTTCTGCTCTATTGGACTTGGGGTGGAAGCCAAGCGAGACTATCATTTTCTGCAGTTGGGATGCTGAGGAATTTGGGATGATAGGATCAACTGAGTGGGTTGAACACAATCTTATTAAGCTTGGCTCCAAAGCTGTACCATACCTTAATGTGGACTGCGCTGTGCAAGGTCCTGGTTTCTTTGTTGGTTCAACTCCTCAGCTAGACAGTCTTATTCTTGAGGTCACAAAAATGGTTCTTGGCAAGTGTCAATTGCAAGAAGCGATTCAAGAGAAAGAAGAGGGCTGA

>Glyma16g18045.1   sequence type=predicted peptide   gene model=Glyma16g18045   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MATVKLKLDSVCTRTAALLDIARRFSALLDLGWKPSETIIFCSWDAEEFGMIGSTEWVEHNLIKLGSKAVPYLNVDCAVQGPGFFVGSTPQLDSLILEVTKMVLGKCQLQEAIQEKEEG*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo