SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma16g17820): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma16g17820): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma16g17820

Feature Type:gene_model
Chromosome:Gm16
Start:19517548
stop:19518965
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma16g17820
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G38400AT Annotation by Michelle Graham. TAIR10: alanine:glyoxylate aminotransferase 3 | chr2:16083779-16085974 FORWARD LENGTH=477 SoyBaseE_val: 4.00E-51ISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0008453GO-mf Annotation by Michelle Graham. GO Molecular Function: alanine-glyoxylate transaminase activity SoyBaseN/AISS
GO:0008483GO-mf Annotation by Michelle Graham. GO Molecular Function: transaminase activity SoyBaseN/AISS
GO:0030170GO-mf Annotation by Michelle Graham. GO Molecular Function: pyridoxal phosphate binding SoyBaseN/AISS
PTHR11986Panther AMINOTRANSFERASE CLASS III JGI ISS
PTHR11986:SF23Panther AMINOTRANSFERASE JGI ISS
PF00202PFAM Aminotransferase class-III JGI ISS
UniRef100_B0M1A8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Peroxisomal aminotransferase (Fragment) n=1 Tax=Glycine max RepID=B0M1A8_SOYBN SoyBaseE_val: 8.00E-59ISS
UniRef100_UPI000233EA6DUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233EA6D related cluster n=1 Tax=unknown RepID=UPI000233EA6D SoyBaseE_val: 2.00E-62ISS

Expression Patterns of Glyma16g17820
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma16g17820 not represented in the dataset
Glyma16g17820 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma16g17820 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma16g17820
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma16g17820
>Glyma16g17820.1   sequence type=CDS   gene model=Glyma16g17820   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TTTATATTTAAAGATCAACTTTTTTTAAATTATAGTTTGTATTGTAGAGTCATTTTGAAAGAAAGGCTCACTGCCCTCAAGGACAAATATGAATTAATTGGTGATGTCAGAGGAAGAGGCCTAATGCTAGGAGTTGAACTTGTCACTGATCGTGAACTTAAAACTCCAGCAAAAAATGAAACATTGCATGTAATGGACCAAATGAAAGAACTAGGAGTACTTATTGGTAAGGGTGGTTACTATGGAAATGTCTTCAGAATTACACCTCCCTTGTGTTTCACCAAAGAAGATGCAGACTTTGTAGCAGACGCAATGGACTTGACCTTGTCTAGAATGTGA
Predicted protein sequences of Glyma16g17820
>Glyma16g17820.1   sequence type=predicted peptide   gene model=Glyma16g17820   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
FIFKDQLFLNYSLYCRVILKERLTALKDKYELIGDVRGRGLMLGVELVTDRELKTPAKNETLHVMDQMKELGVLIGKGGYYGNVFRITPPLCFTKEDADFVADAMDLTLSRM*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo