|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT1G64230 | AT | Annotation by Michelle Graham. TAIR10: ubiquitin-conjugating enzyme 28 | chr1:23833792-23835220 FORWARD LENGTH=190 | SoyBase | E_val: 2.00E-51 | ISS |
GO:0006301 | GO-bp | Annotation by Michelle Graham. GO Biological Process: postreplication repair | SoyBase | N/A | ISS |
GO:0006511 | GO-bp | Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process | SoyBase | N/A | ISS |
GO:0006635 | GO-bp | Annotation by Michelle Graham. GO Biological Process: fatty acid beta-oxidation | SoyBase | N/A | ISS |
GO:0016558 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein import into peroxisome matrix | SoyBase | N/A | ISS |
GO:0042023 | GO-bp | Annotation by Michelle Graham. GO Biological Process: DNA endoreduplication | SoyBase | N/A | ISS |
GO:0043161 | GO-bp | Annotation by Michelle Graham. GO Biological Process: proteasomal ubiquitin-dependent protein catabolic process | SoyBase | N/A | ISS |
GO:0043248 | GO-bp | Annotation by Michelle Graham. GO Biological Process: proteasome assembly | SoyBase | N/A | ISS |
GO:0044265 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cellular macromolecule catabolic process | SoyBase | N/A | ISS |
GO:0048193 | GO-bp | Annotation by Michelle Graham. GO Biological Process: Golgi vesicle transport | SoyBase | N/A | ISS |
GO:0051510 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of unidimensional cell growth | SoyBase | N/A | ISS |
GO:0051788 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to misfolded protein | SoyBase | N/A | ISS |
GO:0005737 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm | SoyBase | N/A | ISS |
GO:0005886 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane | SoyBase | N/A | ISS |
GO:0004842 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ubiquitin-protein ligase activity | SoyBase | N/A | ISS |
GO:0016881 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: acid-amino acid ligase activity | SoyBase | N/A | ISS |
KOG0417 | KOG | Ubiquitin-protein ligase | JGI | ISS | |
PTHR24068 | Panther | FAMILY NOT NAMED | JGI | ISS | |
PF00179 | PFAM | Ubiquitin-conjugating enzyme | JGI | ISS | |
UniRef100_B6SZE0 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Ubiquitin-conjugating enzyme E2-17 kDa n=8 Tax=Poaceae RepID=B6SZE0_MAIZE | SoyBase | E_val: 1.00E-49 | ISS |
UniRef100_I1MML1 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MML1_SOYBN | SoyBase | E_val: 3.00E-68 | ISS |
Glyma16g17730 not represented in the dataset |
Glyma16g17730 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma.16g103300 | Wm82.a2.v1 | IGC | As supplied by JGI |
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma16g17730.2 sequence type=CDS gene model=Glyma16g17730 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high CCTACAGATAACCCATTTGCTGGACATGTGTTTCTTGTGTCAATTCACTTCCCTCCTGATTATCCTTTCAAACCACCCAAGGTTTCATTCCGCACAAAGGTTTTCCACCCTAACATCAACAGTAATGGAAGTATCTACCTTGACATCCTCAAAGAGCAATGGAGTTCTTCTATCTATATGCTCTCTGCTGACAGACCCCAACCAGATGATCCTCTAGTGCCTGAGATTGCTCACATGTACAAGATTAAGAGAGCCAAGTATGAGGCCACTGCTCGGTCATGGACAGAAAAATATGTCGTGGGCTAA
>Glyma16g17730.2 sequence type=predicted peptide gene model=Glyma16g17730 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high PTDNPFAGHVFLVSIHFPPDYPFKPPKVSFRTKVFHPNINSNGSIYLDILKEQWSSSIYMLSADRPQPDDPLVPEIAHMYKIKRAKYEATARSWTEKYVVG*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||