Glyma16g17691 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma16g17691): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma16g17691): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma16g17691

Feature Type:	gene_model
Chromosome:	Gm16
Start:	19299351
stop:	19300522
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma16g17691

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G80480	AT	Annotation by Michelle Graham. TAIR10: plastid transcriptionally active 17 \| chr1:30258272-30260570 REVERSE LENGTH=444	SoyBase	E_val: 1.00E-32	ISS
GO:0009295	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleoid	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009508	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plastid chromosome	SoyBase	N/A	ISS
GO:0009570	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma	SoyBase	N/A	ISS
PTHR13748	Panther	COBW-RELATED	JGI		ISS
PTHR13748:SF11	Panther	PRLI-INTERACTING FACTOR L	JGI		ISS
PF07683	PFAM	Cobalamin synthesis protein cobW C-terminal domain	JGI		ISS
UniRef100_B9S1U2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Prli-interacting factor l, putative n=1 Tax=Ricinus communis RepID=B9S1U2_RICCO	SoyBase	E_val: 5.00E-53	ISS
UniRef100_D7MGW2	UniRef	Annotation by Michelle Graham. Best UniRef hit: Predicted protein n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7MGW2_ARALL	SoyBase	E_val: 1.00E-62	ISS

Expression Patterns of Glyma16g17691

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma16g17691 not represented in the dataset	Glyma16g17691 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma16g17691 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.16g103800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma16g17691

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma16g17691

Limit To All Plant Sequences

>Glyma16g17691.1   sequence type=CDS   gene model=Glyma16g17691   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTTCCAGAATTTTTTTACTCATTTGTTCTGCATGCCTTGATCTTTCCAAATATATCAACAGAACACAAAGGGCATCATCATCATCATCATGACCATGTGCATGATTCAGCTGTCTCCAGTGTCAGTATAGTAGCAGAGGGAACTCTTGATCTTGATGAGGTTGACGATTGGCTTGAGAGAGTGATTGAAGAAAAAGGAGATGACCTATACAGAATGAAGGGTGTCCTGTCAGTGGATAGTTCTGATCAGAGATATGTGTTTCAGGGGGTGCATTCCATGTTGGACGGCTGTCCAGGAAAAACATGGGAACCTAACGAGAAGAGGATAAACAAGCTTGTCTTCATTGGAAGGAATTTGGATGAAACTGCCCTTAAAAAAGGCTTCAAAGGTTGTTTAGTATAG

Predicted protein sequences of Glyma16g17691

Limit To All Plant Sequences

>Glyma16g17691.1   sequence type=predicted peptide   gene model=Glyma16g17691   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MFPEFFYSFVLHALIFPNISTEHKGHHHHHHDHVHDSAVSSVSIVAEGTLDLDEVDDWLERVIEEKGDDLYRMKGVLSVDSSDQRYVFQGVHSMLDGCPGKTWEPNEKRINKLVFIGRNLDETALKKGFKGCLV*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain