Glyma16g17060 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma16g17060): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma16g17060): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma16g17060

Feature Type:	gene_model
Chromosome:	Gm16
Start:	18338783
stop:	18339856
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma16g17060

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G32520	AT	Annotation by Michelle Graham. TAIR10: serine hydroxymethyltransferase 3 \| chr4:15689642-15692334 REVERSE LENGTH=529	SoyBase	E_val: 1.00E-99	ISS
GO:0006164	GO-bp	Annotation by Michelle Graham. GO Biological Process: purine nucleotide biosynthetic process	SoyBase	N/A	ISS
GO:0006544	GO-bp	Annotation by Michelle Graham. GO Biological Process: glycine metabolic process	SoyBase	N/A	ISS
GO:0006563	GO-bp	Annotation by Michelle Graham. GO Biological Process: L-serine metabolic process	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009536	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plastid	SoyBase	N/A	ISS
GO:0009570	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma	SoyBase	N/A	ISS
GO:0003824	GO-mf	Annotation by Michelle Graham. GO Molecular Function: catalytic activity	SoyBase	N/A	ISS
GO:0004372	GO-mf	Annotation by Michelle Graham. GO Molecular Function: glycine hydroxymethyltransferase activity	SoyBase	N/A	ISS
GO:0030170	GO-mf	Annotation by Michelle Graham. GO Molecular Function: pyridoxal phosphate binding	SoyBase	N/A	ISS
PTHR11680	Panther	SERINE HYDROXYMETHYLTRANSFERASE	JGI		ISS
PF00464	PFAM	Serine hydroxymethyltransferase	JGI		ISS
UniRef100_I1M1L2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Serine hydroxymethyltransferase n=1 Tax=Glycine max RepID=I1M1L2_SOYBN	SoyBase	E_val: 2.00E-113	ISS
UniRef100_UPI000233E90C	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233E90C related cluster n=1 Tax=unknown RepID=UPI000233E90C	SoyBase	E_val: 4.00E-130	ISS

Expression Patterns of Glyma16g17060

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma16g17060 not represented in the dataset	Glyma16g17060 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma16g17060 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.16g108100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma16g17060

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma16g17060

Limit To All Plant Sequences

>Glyma16g17060.1   sequence type=CDS   gene model=Glyma16g17060   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AATTTTTATATGTTATTTGAATTTATGACTAAGAATGATCTATTTTGTCCATGGAATCACATGCAATTGCAAATACTAGGTGATGGAAGTAGCTTCCTAGACTATGGCTTGAGTGAAGCTGATCCTGAAGTTCGCGCAATTATTGACAAGGAAAAGGACCGGCAATTTAAAAGTCTTGAGCTTATTGCTTCTGAGAATTTTACATCTAGAGCAGTGATGGAAGCAGTTGGTTCCTGCCTCACAAATAAATACTCAGAAGGATTGCCGGGTAAAAGGTACTATGGTGGCAATGAGTACATTGATGAGCTTGAAACCCTATGTCAACAAAGGGCTTTGGCTACATTTCATGTAGATGGAAATAAGTGGGGTGTTAATGTTCAAGCTTTATCTAGTTCCCCAGCTAATTTTGCAGTATTCACTGCAGGTTTGGACTTGCCTCACGGAGGACATTTGTCTCATGGGTTCGTGACACCTAAAAAACGTGTATCAGCCACATCAATTTATTTTGAATGTCTTATTGATTATGATATGCTGGAGAAAATTACTACTCTTTTTCGACCAAAACTCATTATTGTTGGTGCCAGTGCTTATCCTCGAGACATTGACTACCCTTGCATGAGAAAAGTATGTTTTGTACTTATGCATTTTCTGGAATTATAA

Predicted protein sequences of Glyma16g17060

Limit To All Plant Sequences

>Glyma16g17060.1   sequence type=predicted peptide   gene model=Glyma16g17060   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
NFYMLFEFMTKNDLFCPWNHMQLQILGDGSSFLDYGLSEADPEVRAIIDKEKDRQFKSLELIASENFTSRAVMEAVGSCLTNKYSEGLPGKRYYGGNEYIDELETLCQQRALATFHVDGNKWGVNVQALSSSPANFAVFTAGLDLPHGGHLSHGFVTPKKRVSATSIYFECLIDYDMLEKITTLFRPKLIIVGASAYPRDIDYPCMRKVCFVLMHFLEL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain