Glyma16g13580 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma16g13580

Feature Type:	gene_model
Chromosome:	Gm16
Start:	14673074
stop:	14675829
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma16g13580

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G48760	AT	Annotation by Michelle Graham. TAIR10: Ribosomal protein L13 family protein \| chr5:19771315-19772686 REVERSE LENGTH=206	SoyBase	E_val: 1.00E-138	ISS
GO:0001510	GO-bp	Annotation by Michelle Graham. GO Biological Process: RNA methylation	SoyBase	N/A	ISS
GO:0006412	GO-bp	Annotation by Michelle Graham. GO Biological Process: translation	SoyBase	N/A	ISS
GO:0009664	GO-bp	Annotation by Michelle Graham. GO Biological Process: plant-type cell wall organization	SoyBase	N/A	ISS
GO:0042545	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell wall modification	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005840	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: ribosome	SoyBase	N/A	ISS
GO:0015934	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: large ribosomal subunit	SoyBase	N/A	ISS
GO:0022625	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosolic large ribosomal subunit	SoyBase	N/A	ISS
GO:0022626	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome	SoyBase	N/A	ISS
GO:0003735	GO-mf	Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome	SoyBase	N/A	ISS
KOG3204	KOG	60S ribosomal protein L13a	JGI		ISS
PTHR11545	Panther	RIBOSOMAL PROTEIN L13	JGI		ISS
PF00572	PFAM	Ribosomal protein L13	JGI		ISS
UniRef100_B9S526	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: 60S ribosomal protein L13a, putative n=1 Tax=Ricinus communis RepID=B9S526_RICCO	SoyBase	E_val: 5.00E-138	ISS
UniRef100_I1MMC9	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MMC9_SOYBN	SoyBase	E_val: 2.00E-146	ISS

Expression Patterns of Glyma16g13580

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma16g13580 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.16g092800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma16g13580

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma16g13580

Limit To All Plant Sequences

>Glyma16g13580.1   sequence type=CDS   gene model=Glyma16g13580   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGTCAGGTTCGGGGATCTGCGCGAAGCGCGTGGTGGTGGACGCCCGGCACCACATGCTGGGTCGGCTCGCCTCGATTGTGGCAAAGGAGCTGCTGAACGGACAAAAAGTGGTGGTCGTGCGATGCGAAGAGATTTGCATCTCCGGTGGTCTGGTGAGGCAGAAAATGAAGTACTTGAGGTTCCTCCGCAAACGCATGAACACCAAGCCTTCCCACGGCCCCATCCACTTCCGCGCACCCTCCAAGATCTTCTGGCGCACCGTTCGTGGAATGATACCACACAAGACAAAGCGTGGGGAAGCCGCTCTCGCTCGTTTGAAGGTTTATGAGGGAATTCCTCCTCCATATGACAAGATAAAGAGAATGGTTGTTCCAGATGCTCTGAAGGTGTTGAGACTTCAGAAAGGACACAAGTACTGCATACTGGGCAGGTTGTCATCTGAAGTTGGATGGAGCTACTATGATACCATCAGGGAGCTAGAAAAGAAGAGAAAGGAAAAGGCACAATTGGTTTATGAGAGAAAGAAGCAGCTCAACAAATTAAGGGTGAAAGCCGAGAAGGTTGCTGAAGACAAGCTCGGTTCCCAACTTGATATTCTTGCTCCAGTCAAGTACTGA

Predicted protein sequences of Glyma16g13580

Limit To All Plant Sequences

>Glyma16g13580.1   sequence type=predicted peptide   gene model=Glyma16g13580   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICISGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGEAALARLKVYEGIPPPYDKIKRMVVPDALKVLRLQKGHKYCILGRLSSEVGWSYYDTIRELEKKRKEKAQLVYERKKQLNKLRVKAEKVAEDKLGSQLDILAPVKY*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain