SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma16g10851): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma16g10851): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma16g10851

Feature Type:gene_model
Chromosome:Gm16
Start:11182960
stop:11183989
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
ATCG00050AT Annotation by Michelle Graham. TAIR10: ribosomal protein S16 | chrC:5084-6188 REVERSE LENGTH=79 SoyBaseE_val: 1.00E-26ISS
GO:0006091GO-bp Annotation by Michelle Graham. GO Biological Process: generation of precursor metabolites and energy SoyBaseN/AISS
GO:0006354GO-bp Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, elongation SoyBaseN/AISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0010267GO-bp Annotation by Michelle Graham. GO Biological Process: production of ta-siRNAs involved in RNA interference SoyBaseN/AISS
GO:0015979GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis SoyBaseN/AISS
GO:0035196GO-bp Annotation by Michelle Graham. GO Biological Process: production of miRNAs involved in gene silencing by miRNA SoyBaseN/AISS
GO:0051607GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to virus SoyBaseN/AISS
GO:0000312GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plastid small ribosomal subunit SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
PTHR12919Panther 30S RIBOSOMAL PROTEIN S16 JGI ISS
PTHR12919:SF3Panther CHLOROPLAST 30S RIBOSOMAL PROTEIN S16 JGI ISS
PF00886PFAM Ribosomal protein S16 JGI ISS
UniRef100_Q2PMS5UniRef Annotation by Michelle Graham. Best UniRef hit: 30S ribosomal protein S16, chloroplastic n=25 Tax=core eudicotyledons RepID=RR16_SOYBN SoyBaseE_val: 2.00E-42ISS
UniRef100_Q2PMS5UniRef Annotation by Michelle Graham. Most informative UniRef hit: 30S ribosomal protein S16, chloroplastic n=25 Tax=core eudicotyledons RepID=RR16_SOYBN SoyBaseE_val: 2.00E-42ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma16g10851 not represented in the dataset

Glyma16g10851 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.16g088900 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma16g10851.1   sequence type=CDS   gene model=Glyma16g10851   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCTAAGCCGTACAAGGATAAAACTTCTTATACGTTTCCAGGGGCCATTTATCGAATCGTTGCAATCGATGCTCGATCTCAAAGAGAGGGAAGAGATCTTCAAAAATTAGGTTTTTATGATCCAATAAAGAATCAAACCTATTTAAATATTCCTGTTATTCTATATTTCCTTGAACGAGGTGCTCAACCTACAGGAATTGTTCAGGATATTTCAAAAAGGGCTGGTGTTTTTAAGGAACTTAGCTCAAATCATCAAACGAAATTTCATTAA

>Glyma16g10851.1   sequence type=predicted peptide   gene model=Glyma16g10851   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSKPYKDKTSYTFPGAIYRIVAIDARSQREGRDLQKLGFYDPIKNQTYLNIPVILYFLERGAQPTGIVQDISKRAGVFKELSSNHQTKFH*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo