SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma16g10750): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma16g10750): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma16g10750

Feature Type:gene_model
Chromosome:Gm16
Start:10993777
stop:10998125
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G48580AT Annotation by Michelle Graham. TAIR10: FK506- and rapamycin-binding protein 15 kD-2 | chr5:19696156-19697304 REVERSE LENGTH=163 SoyBaseE_val: 3.00E-76ISS
GO:0000413GO-bp Annotation by Michelle Graham. GO Biological Process: protein peptidyl-prolyl isomerization SoyBaseN/AISS
GO:0006457GO-bp Annotation by Michelle Graham. GO Biological Process: protein folding SoyBaseN/AISS
GO:0018208GO-bp Annotation by Michelle Graham. GO Biological Process: peptidyl-proline modification SoyBaseN/AISS
GO:0019932GO-bp Annotation by Michelle Graham. GO Biological Process: second-messenger-mediated signaling SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0005783GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009543GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid lumen SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0003755GO-mf Annotation by Michelle Graham. GO Molecular Function: peptidyl-prolyl cis-trans isomerase activity SoyBaseN/AISS
GO:0005528GO-mf Annotation by Michelle Graham. GO Molecular Function: FK506 binding SoyBaseN/AISS
KOG0549 KOG FKBP-type peptidyl-prolyl cis-trans isomerase JGI ISS
PTHR10516Panther FK506 BINDING PROTEIN JGI ISS
PTHR10516:SF118Panther PEPTIDYL-PROLYL CIS-TRANS ISOMERASE JGI ISS
PF00254PFAM FKBP-type peptidyl-prolyl cis-trans isomerase JGI ISS
UniRef100_C6SYR2UniRef Annotation by Michelle Graham. Best UniRef hit: Peptidyl-prolyl cis-trans isomerase n=1 Tax=Glycine max RepID=C6SYR2_SOYBN SoyBaseE_val: 1.00E-106ISS
UniRef100_C6SYR2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Peptidyl-prolyl cis-trans isomerase n=1 Tax=Glycine max RepID=C6SYR2_SOYBN SoyBaseE_val: 1.00E-106ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma16g10750 not represented in the dataset

Glyma16g10750 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma03g21680 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.16g088200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma16g10750.1   sequence type=CDS   gene model=Glyma16g10750   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGTTTCCGTCATTCCATCATGAACGCTCTTCCCATTCTCCTCTTCTTCCTCTTCGTTTCTGCATTAGTTTCTGCGAAGAAAACTGGTGATGTGACGGAGCTGCAAATTGGCGTGAAGCATAAACCAGTATCATGTGAAGTTCAGGCACACAAAGGTGACAGAGTCAAAGTACACTATAGGGGAAAACTCACTGATGGAACTGTTTTCGATTCTAGCTTTGAAAGAAATAATCCAATTGAATTTGAGCTTGGTACTGGTCAAGTGATCAAAGGTTGGGACCAGGGATTATTGGGAATGTGTCTTGGTGAGAAGCGTAAGCTGAAAATACCATCAAAACTTGGCTATGGAGAGCAGGGTTCCCCACCCACTATTCCAGGTGGTGCTACACTCATATTTGACGCTGAGCTTGTGGGAGTGAACGACAAAAGTTTAGGCGAAGGAAAAGGAAACAACGAACTGTAG

>Glyma16g10750.1   sequence type=predicted peptide   gene model=Glyma16g10750   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSFRHSIMNALPILLFFLFVSALVSAKKTGDVTELQIGVKHKPVSCEVQAHKGDRVKVHYRGKLTDGTVFDSSFERNNPIEFELGTGQVIKGWDQGLLGMCLGEKRKLKIPSKLGYGEQGSPPTIPGGATLIFDAELVGVNDKSLGEGKGNNEL*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo