Glyma16g09760 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma16g09760

Feature Type:	gene_model
Chromosome:	Gm16
Start:	9593792
stop:	9595077
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma16g09760

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G07390	AT	Annotation by Michelle Graham. TAIR10: auxin-responsive family protein \| chr3:2365452-2366273 FORWARD LENGTH=273	SoyBase	E_val: 2.00E-36	ISS
GO:0006007	GO-bp	Annotation by Michelle Graham. GO Biological Process: glucose catabolic process	SoyBase	N/A	ISS
GO:0009733	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus	SoyBase	N/A	ISS
GO:0010102	GO-bp	Annotation by Michelle Graham. GO Biological Process: lateral root morphogenesis	SoyBase	N/A	ISS
GO:0030198	GO-bp	Annotation by Michelle Graham. GO Biological Process: extracellular matrix organization	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0031225	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: anchored to membrane	SoyBase	N/A	ISS
GO:0046658	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: anchored to plasma membrane	SoyBase	N/A	ISS
GO:0005201	GO-mf	Annotation by Michelle Graham. GO Molecular Function: extracellular matrix structural constituent	SoyBase	N/A	ISS
PF04526	PFAM	Protein of unknown function (DUF568)	JGI		ISS
UniRef100_C5HU39	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: AIR12 n=1 Tax=Glycine max RepID=C5HU39_SOYBN	SoyBase	E_val: 2.00E-128	ISS
UniRef100_I1MM67	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MM67_SOYBN	SoyBase	E_val: 2.00E-174	ISS

Expression Patterns of Glyma16g09760

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma16g09760

Paralog	Evidence	Comments
Glyma03g22260	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma16g09760 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.16g084300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma16g09760

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma16g09760

Limit To All Plant Sequences

>Glyma16g09760.1   sequence type=CDS   gene model=Glyma16g09760   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCACTCCATGATCTACCCTTCACACCCATGACCACCATTTCCCTCTTCATCATTCTATTTTCTCTATTTTCCACCCCTTCCCATTCTGCCCTCACTTGTGCTTCCCAGAAGCTCAACCGCACCTACGCCAACTGCACCAACCTCCCCACCCTCGGCGCCACCCTCCACTTCACCTTCAACGCCACCAACCGCACCCTCTCCGTCGCCTTCTCCGCCTCTCCTCCCTCCCCCTCCGGCTGGGTCGCCTGGGGCCTCAACCTTGCCGGCGGCGGAATGGCCGGCGCCGAAGCCCTCCTCGCCCTCCCCTCCACCTCCGGCTCCGCCGTCACCCTCCGCCGCTACAACCTCACCTCCTACAAGAGCATCGACGTAGTCAAGGCCTTCACCTTCGAATCGTGGGACCTCTCCGCCGAAGAGACCAACGGCGCCATAACGATCTACGGCACCGTCAAGATCCCCGATTCGGCGGAGAACGTCAGCCACGTGTGGCAGGTGGGTCCCGTTGCGGCGGGGGTGCCCGCGGTGCACGGCTTCAAGGACGACAACATTCACGCCAAGGCCGCTCTCCCCGTCGCGCTTGCGGGGAGCAGCGGATCGTCAGCAGCGAGTGGCGAAAACGCGACCACACCCGCGAGTGGGGACAAGAAGAACGGTGCTGCTGCTGCGGAGAGGCTTGGGTTGGGTTTTCACTTTTGGTTGGTTTTCGCATTGATGGTTGGTGTTGTTGCTCTTTGA

Predicted protein sequences of Glyma16g09760

Limit To All Plant Sequences

>Glyma16g09760.1   sequence type=predicted peptide   gene model=Glyma16g09760   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MALHDLPFTPMTTISLFIILFSLFSTPSHSALTCASQKLNRTYANCTNLPTLGATLHFTFNATNRTLSVAFSASPPSPSGWVAWGLNLAGGGMAGAEALLALPSTSGSAVTLRRYNLTSYKSIDVVKAFTFESWDLSAEETNGAITIYGTVKIPDSAENVSHVWQVGPVAAGVPAVHGFKDDNIHAKAALPVALAGSSGSSAASGENATTPASGDKKNGAAAAERLGLGFHFWLVFALMVGVVAL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain