SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma16g09450): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma16g09450): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma16g09450

Feature Type:gene_model
Chromosome:Gm16
Start:9356452
stop:9358837
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G25400AT Annotation by Michelle Graham. TAIR10: CONTAINS InterPro DOMAIN/s: NTP Pyrophosphohydrolase MazG-related, RS21-C6 (InterPro:IPR011394), EAR (InterPro:IPR009039), NTP pyrophosphohydrolase MazG, putative catalytic core (InterPro:IPR004518); Has 1123 Blast hits to 1121 proteins in 452 species: Archae - 22; Bacteria - 753; Metazoa - 81; Fungi - 3; Plants - 83; Viruses - 0; Other Eukaryotes - 181 (source: NCBI BLink). | chr3:9213236-9214144 FORWARD LENGTH=141 SoyBaseE_val: 2.00E-59ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PTHR14552Panther FAMILY NOT NAMED JGI ISS
PTHR14552:SF2Panther SUBFAMILY NOT NAMED JGI ISS
PF03819PFAM MazG nucleotide pyrophosphohydrolase domain JGI ISS
UniRef100_C6T0F8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T0F8_SOYBN SoyBaseE_val: 2.00E-83ISS
UniRef100_G7KY22UniRef Annotation by Michelle Graham. Most informative UniRef hit: dCTP pyrophosphatase n=1 Tax=Medicago truncatula RepID=G7KY22_MEDTR SoyBaseE_val: 8.00E-62ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma16g09450 not represented in the dataset

Glyma16g09450 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma03g22333 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.16g083500 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma16g09450.1   sequence type=CDS   gene model=Glyma16g09450   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACTGGGGTTCCTCAAGAAGCACCCGTTTCTCTTGATCAGCTCAAGCAGATACTGGATGAGTTTGCAAAGGAGAGGGATTGGGAGCAGTATCATAGCCCAAGGAACCTCCTTTTGGCTTTGGTGGGTGAAGTGGGAGAATTGTCTGAGATATTTCAGTGGAAAGGGGAGGTTCCAAAGGGTCTTCCAGATTGGAAAGAAGAGGAAAAGGTTCATCTTGGTGAAGAGCTTTCAGATGTGTTGCTTTACCTTGTGAGGCTCTCAGACATTTGTGGTGTTGATCTTGGCAAAGCTGCTCTAAGAAAGGTCCAACTCAATGCCATAAAATACCCAAAAAAGGTTAATGATGATGCAATTACTCAAGATGCTAATTGA

>Glyma16g09450.1   sequence type=predicted peptide   gene model=Glyma16g09450   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTGVPQEAPVSLDQLKQILDEFAKERDWEQYHSPRNLLLALVGEVGELSEIFQWKGEVPKGLPDWKEEEKVHLGEELSDVLLYLVRLSDICGVDLGKAALRKVQLNAIKYPKKVNDDAITQDAN*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo