Glyma16g07960 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma16g07960): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma16g07960): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma16g07960

Feature Type:	gene_model
Chromosome:	Gm16
Start:	7205140
stop:	7209409
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma16g07960

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G27810	AT	Annotation by Michelle Graham. TAIR10: myb domain protein 21 \| chr3:10307596-10310093 FORWARD LENGTH=226	SoyBase	E_val: 3.00E-87	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0009740	GO-bp	Annotation by Michelle Graham. GO Biological Process: gibberellic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0009753	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus	SoyBase	N/A	ISS
GO:0009867	GO-bp	Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0048441	GO-bp	Annotation by Michelle Graham. GO Biological Process: petal development	SoyBase	N/A	ISS
GO:0048443	GO-bp	Annotation by Michelle Graham. GO Biological Process: stamen development	SoyBase	N/A	ISS
GO:0048481	GO-bp	Annotation by Michelle Graham. GO Biological Process: ovule development	SoyBase	N/A	ISS
GO:0080086	GO-bp	Annotation by Michelle Graham. GO Biological Process: stamen filament development	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
KOG0048	KOG	Transcription factor, Myb superfamily	JGI		ISS
PTHR10641	Panther	MYB-RELATED	JGI		ISS
PF00249	PFAM	Myb-like DNA-binding domain	JGI		ISS
UniRef100_Q0PJJ6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: MYB transcription factor MYB181 n=1 Tax=Glycine max RepID=Q0PJJ6_SOYBN	SoyBase	E_val: 2.00E-154	ISS
UniRef100_Q0PJJ6	UniRef	Annotation by Michelle Graham. Best UniRef hit: MYB transcription factor MYB181 n=1 Tax=Glycine max RepID=Q0PJJ6_SOYBN	SoyBase	E_val: 2.00E-154	ISS

Expression Patterns of Glyma16g07960

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma16g07960 not represented in the dataset	Glyma16g07960 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma16g07960 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.16g073000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma16g07960

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma16g07960

Limit To All Plant Sequences

>Glyma16g07960.1   sequence type=CDS   gene model=Glyma16g07960   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATAAAAAACAACTGTGCAACACGTCTCAAGATCCTGAAGTGAGAAAAGGACCTTGGACGATGGAAGAAGACTTGATCTTGATCAACTATATTGCAAATCATGGGGAAGGTGTTTGGAATTCTTTGGCCAAAGCTGCTGGTCTCAAACGTACCGGAAAGAGTTGCCGGCTAAGGTGGCTAAACTACCTCCGTCCTGATGTTAGAAGAGGGAATATTACACCCGAGGAACAACTTTTGATCATGGAGCTTCACGCAAAGTGGGGAAACAGGTGGTCCAAAATTGCCAAGCATCTACCTGGTAGGACAGATAATGAGATCAAGAACTATTGGAGGACCAGGATCCAGAAGCACATCAAGCAAGCTGAGAACTTTCAGCAACAAATCAGCAATAACTCTGAGATAAATGATCACCAAGCTAGCACTAGCCATGTTTCTACCATGGCTGAACCCATGGAGACCTATTCTCCACCCTTTTATCAAGGAATGTTAGAGCCATTTTCTTCAATTCAGTTCCCCACAATTAATCCTGATCAATCCAGTTGTTGTACCAATGACAACAACAACAGCATTAACTATTGGAGCATGGAGGATATCTGGTCAATGCAGTTACTGAACGGGGATTAA

Predicted protein sequences of Glyma16g07960

Limit To All Plant Sequences

>Glyma16g07960.1   sequence type=predicted peptide   gene model=Glyma16g07960   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDKKQLCNTSQDPEVRKGPWTMEEDLILINYIANHGEGVWNSLAKAAGLKRTGKSCRLRWLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNYWRTRIQKHIKQAENFQQQISNNSEINDHQASTSHVSTMAEPMETYSPPFYQGMLEPFSSIQFPTINPDQSSCCTNDNNNSINYWSMEDIWSMQLLNGD*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain