SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma16g07870): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma16g07870): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma16g07870

Feature Type:gene_model
Chromosome:Gm16
Start:7133970
stop:7136463
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G40370AT Annotation by Michelle Graham. TAIR10: Glutaredoxin family protein | chr5:16147826-16149052 REVERSE LENGTH=111 SoyBaseE_val: 5.00E-54ISS
GO:0045454GO-bp Annotation by Michelle Graham. GO Biological Process: cell redox homeostasis SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0048046GO-cc Annotation by Michelle Graham. GO Cellular Compartment: apoplast SoyBaseN/AISS
GO:0008794GO-mf Annotation by Michelle Graham. GO Molecular Function: arsenate reductase (glutaredoxin) activity SoyBaseN/AISS
GO:0009055GO-mf Annotation by Michelle Graham. GO Molecular Function: electron carrier activity SoyBaseN/AISS
GO:0015035GO-mf Annotation by Michelle Graham. GO Molecular Function: protein disulfide oxidoreductase activity SoyBaseN/AISS
KOG1752 KOG Glutaredoxin and related proteins JGI ISS
PTHR10168Panther GLUTAREDOXIN JGI ISS
PF00462PFAM Glutaredoxin JGI ISS
UniRef100_B3F8F4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Glutaredoxin n=1 Tax=Solanum tuberosum RepID=B3F8F4_SOLTU SoyBaseE_val: 7.00E-52ISS
UniRef100_C6SVF6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SVF6_SOYBN SoyBaseE_val: 3.00E-72ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma16g07870 not represented in the dataset

Glyma16g07870 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.16g072400 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma16g07870.1   sequence type=CDS   gene model=Glyma16g07870   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTCTGCCCAAAGCTAAGGAGATCGTGTCGTCCAATTCCGTCGTCGTTTTCAGCAAAACCTATTGCCCTTTCTGCGTCGATGTGAAGAAGCTCTTCGGTGACCTCGGTGCCAATTACAAGGCCATCGAACTCGACACTGAATCCGATGGAAAAGAGCTCCAAGCAGCATTAGTTGAGTGGACGGACCAGCGAACCGTGCCTAATGTGTTTATTGGTGGAAACCACATTGGTGGCTGTGACTCAACAACTGCCCTGCACACTCAGGGGAAGCTGGTTCCTCTGCTGATATCTGCTGGAGCTGTTGCCAAATCAACTGCTTAA

>Glyma16g07870.1   sequence type=predicted peptide   gene model=Glyma16g07870   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MALPKAKEIVSSNSVVVFSKTYCPFCVDVKKLFGDLGANYKAIELDTESDGKELQAALVEWTDQRTVPNVFIGGNHIGGCDSTTALHTQGKLVPLLISAGAVAKSTA*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo