Glyma16g07870 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma16g07870): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma16g07870): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma16g07870

Feature Type:	gene_model
Chromosome:	Gm16
Start:	7133970
stop:	7136463
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma16g07870

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G40370	AT	Annotation by Michelle Graham. TAIR10: Glutaredoxin family protein \| chr5:16147826-16149052 REVERSE LENGTH=111	SoyBase	E_val: 5.00E-54	ISS
GO:0045454	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell redox homeostasis	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005773	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuole	SoyBase	N/A	ISS
GO:0005794	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0048046	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: apoplast	SoyBase	N/A	ISS
GO:0008794	GO-mf	Annotation by Michelle Graham. GO Molecular Function: arsenate reductase (glutaredoxin) activity	SoyBase	N/A	ISS
GO:0009055	GO-mf	Annotation by Michelle Graham. GO Molecular Function: electron carrier activity	SoyBase	N/A	ISS
GO:0015035	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein disulfide oxidoreductase activity	SoyBase	N/A	ISS
KOG1752	KOG	Glutaredoxin and related proteins	JGI		ISS
PTHR10168	Panther	GLUTAREDOXIN	JGI		ISS
PF00462	PFAM	Glutaredoxin	JGI		ISS
UniRef100_B3F8F4	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Glutaredoxin n=1 Tax=Solanum tuberosum RepID=B3F8F4_SOLTU	SoyBase	E_val: 7.00E-52	ISS
UniRef100_C6SVF6	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SVF6_SOYBN	SoyBase	E_val: 3.00E-72	ISS

Expression Patterns of Glyma16g07870

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma16g07870 not represented in the dataset	Glyma16g07870 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma16g07870 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.16g072400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma16g07870

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma16g07870

Limit To All Plant Sequences

>Glyma16g07870.1   sequence type=CDS   gene model=Glyma16g07870   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTCTGCCCAAAGCTAAGGAGATCGTGTCGTCCAATTCCGTCGTCGTTTTCAGCAAAACCTATTGCCCTTTCTGCGTCGATGTGAAGAAGCTCTTCGGTGACCTCGGTGCCAATTACAAGGCCATCGAACTCGACACTGAATCCGATGGAAAAGAGCTCCAAGCAGCATTAGTTGAGTGGACGGACCAGCGAACCGTGCCTAATGTGTTTATTGGTGGAAACCACATTGGTGGCTGTGACTCAACAACTGCCCTGCACACTCAGGGGAAGCTGGTTCCTCTGCTGATATCTGCTGGAGCTGTTGCCAAATCAACTGCTTAA

Predicted protein sequences of Glyma16g07870

Limit To All Plant Sequences

>Glyma16g07870.1   sequence type=predicted peptide   gene model=Glyma16g07870   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MALPKAKEIVSSNSVVVFSKTYCPFCVDVKKLFGDLGANYKAIELDTESDGKELQAALVEWTDQRTVPNVFIGGNHIGGCDSTTALHTQGKLVPLLISAGAVAKSTA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain