SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma16g06730

Feature Type:gene_model
Chromosome:Gm16
Start:6049401
stop:6050690
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma16g06730
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G14280AT Annotation by Michelle Graham. TAIR10: DNA-binding storekeeper protein-related | chr5:4609123-4611444 FORWARD LENGTH=572 SoyBaseE_val: 4.00E-96ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0016021GO-cc Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane SoyBaseN/AISS
PF03798PFAM TLC domain JGI ISS
UniRef100_G7L823UniRef Annotation by Michelle Graham. Most informative UniRef hit: Oxidoreductase aldo/keto reductase family n=1 Tax=Medicago truncatula RepID=G7L823_MEDTR SoyBaseE_val: 4.00E-102ISS
UniRef100_I1MLN2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MLN2_SOYBN SoyBaseE_val: 0ISS

Expression Patterns of Glyma16g06730
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma16g06730
ParalogEvidenceComments
Glyma19g24560 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma16g06730 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.16g062400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma16g06730
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma16g06730
>Glyma16g06730.1   sequence type=CDS   gene model=Glyma16g06730   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACAAGAACAGCACCGACAACCTCGTTAGCATCATTAGAAAGCTGGGCCATCTTGGCATTCTTCTTGATGTTCCTCTCCATATACTTGATCGGATACTTCCTTATTTTCCGCAAACAAACCCTCAAGATCCGACCCGAATTCTCCAGCTGTCTGATCTCACTCTTCCACGGCACCCCCGCCGCAATATTGGGCTCCGCCGCAATTCTCTCCGACAGCCGCCAGGGCTTCGCCGCCCCCAACACAAGCTTCCAGAAACTCGTCCTCGACTACAGCGCCGCCTACTTCCTCACAGATCTGCTCCACTATGTTTTTTTCTACCCTAAAGACGTGCTCTTCATCGCGCACCACGTGGCGACCCTCTTCGTGGTCCTCACGTGCCGCTACGCCGTCTCGCACGGCGCCTTTGCGGTCCTCGTCCTCCTCGTCCTCGCTGAGATCACCAGCGCGTGTCAGAACGCGTGGACTCTCACTGGGGCAAGAAAGGACCAGGACGCGCTCGCCAGGCGCGTGCATCACGCGCTCTCGCCGCCGTTTTACGCGGCGTATTCGGTCGTCAGGGGGTTTGTTGGGCCCTACTTTGTTTACCGGATGATTGTGTTCTACGTGAGTGGGGGCGCGCGTGGGCTTGTGCCTGTTTGGGCCTGGGCCTCTTGGGTCTTGGTTGTTGTTATGGCTATTGGGGTTAGCATTATGTGGATTTCTAATCTTTGGGTTCAGTTTTTTAGGGAAAGGAGGGGGAAATTAGAAGAGAAAATTAGATAG
Predicted protein sequences of Glyma16g06730
>Glyma16g06730.1   sequence type=predicted peptide   gene model=Glyma16g06730   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTRTAPTTSLASLESWAILAFFLMFLSIYLIGYFLIFRKQTLKIRPEFSSCLISLFHGTPAAILGSAAILSDSRQGFAAPNTSFQKLVLDYSAAYFLTDLLHYVFFYPKDVLFIAHHVATLFVVLTCRYAVSHGAFAVLVLLVLAEITSACQNAWTLTGARKDQDALARRVHHALSPPFYAAYSVVRGFVGPYFVYRMIVFYVSGGARGLVPVWAWASWVLVVVMAIGVSIMWISNLWVQFFRERRGKLEEKIR*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo