Glyma16g06500 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma16g06500

Feature Type:	gene_model
Chromosome:	Gm16
Start:	5852350
stop:	5853431
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma16g06500

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G05950	AT	Annotation by Michelle Graham. TAIR10: RmlC-like cupins superfamily protein \| chr3:1781130-1781964 REVERSE LENGTH=229	SoyBase	E_val: 2.00E-99	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0048046	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: apoplast	SoyBase	N/A	ISS
GO:0030145	GO-mf	Annotation by Michelle Graham. GO Molecular Function: manganese ion binding	SoyBase	N/A	ISS
GO:0045735	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nutrient reservoir activity	SoyBase	N/A	ISS
PF00190	PFAM	Cupin	JGI		ISS
UniRef100_C7S8B7	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Germin-like protein 3 n=1 Tax=Glycine max RepID=C7S8B7_SOYBN	SoyBase	E_val: 1.00E-158	ISS
UniRef100_C7S8B7	UniRef	Annotation by Michelle Graham. Best UniRef hit: Germin-like protein 3 n=1 Tax=Glycine max RepID=C7S8B7_SOYBN	SoyBase	E_val: 1.00E-158	ISS

Expression Patterns of Glyma16g06500

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma16g06500 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.16g060900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma16g06500

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma16g06500

Limit To All Plant Sequences

>Glyma16g06500.1   sequence type=CDS   gene model=Glyma16g06500   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAAGTTGTATACTTCCTTGTTGCTATCTTGGCTTTGACATCCACTGTGGTCTCTGCCTATGACCCTAGTCCTCTGCAAGATTTTTGTGTGGCGGCCAAAGAAAAAGATGGTGTATTTGTGAATGGAAAATTCTGCAAAGATCCCAAGCTTGTGAAAGCTGAAGATTTCTTCAAACATGTGGAACCTGCGAATACTGCGAATCCACTAGGTTCACAAGTGACTCCGGTCTTTGTTGATCAACTACCTGGACTAAACACACTGGGCATATCTTTGGCTCGCATAGATTATGCACCAAAGGGTTTAAACCCTCCCCACACTCATCCTCGTGGTACTGAGATCCTTATAGTACTTGAGGGAACTCTTTATGTTGGATTTGTGACTTCTAATCAAGATGGAAATCGCCTCTTCACCAAAGTGCTGAACAAGGGTGATGTGTTTGTCTTCCCAATTGGTCTCATTCATTTCCAACTCAATGTGGGGTATGGTAATGCTGTTGCCATTGCTGGTCTTAGTAGCCAAAATCCAGGAACTATCACTATTGCAAATGCTTTGTTTAAAGCTAATCCTCCTATTTCTCCTGAGGTTCTCACCAAAGCCTTCCAGGTGGACAAGAGCACAATTGATTATCTTCAAAAGCAATCTTGGTATGACAACAATAACTAG

Predicted protein sequences of Glyma16g06500

Limit To All Plant Sequences

>Glyma16g06500.1   sequence type=predicted peptide   gene model=Glyma16g06500   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKVVYFLVAILALTSTVVSAYDPSPLQDFCVAAKEKDGVFVNGKFCKDPKLVKAEDFFKHVEPANTANPLGSQVTPVFVDQLPGLNTLGISLARIDYAPKGLNPPHTHPRGTEILIVLEGTLYVGFVTSNQDGNRLFTKVLNKGDVFVFPIGLIHFQLNVGYGNAVAIAGLSSQNPGTITIANALFKANPPISPEVLTKAFQVDKSTIDYLQKQSWYDNNN*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain