Glyma16g05460 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma16g05460): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma16g05460): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma16g05460

Feature Type:	gene_model
Chromosome:	Gm16
Start:	4770306
stop:	4772484
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma16g05460

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G14040	AT	Annotation by Michelle Graham. TAIR10: phosphate transporter 3;1 \| chr5:4531059-4532965 REVERSE LENGTH=375	SoyBase	E_val: 2.00E-173	ISS
GO:0006007	GO-bp	Annotation by Michelle Graham. GO Biological Process: glucose catabolic process	SoyBase	N/A	ISS
GO:0006098	GO-bp	Annotation by Michelle Graham. GO Biological Process: pentose-phosphate shunt	SoyBase	N/A	ISS
GO:0006810	GO-bp	Annotation by Michelle Graham. GO Biological Process: transport	SoyBase	N/A	ISS
GO:0009651	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to salt stress	SoyBase	N/A	ISS
GO:0005618	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cell wall	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0005743	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial inner membrane	SoyBase	N/A	ISS
GO:0005774	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
KOG0767	KOG	Mitochondrial phosphate carrier protein	JGI		ISS
PTHR24089	Panther	FAMILY NOT NAMED	JGI		ISS
PTHR24089:SF22	Panther	SUBFAMILY NOT NAMED	JGI		ISS
PF00153	PFAM	Mitochondrial carrier protein	JGI		ISS
UniRef100_I1MLB6	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MLB6_SOYBN	SoyBase	E_val: 0	ISS
UniRef100_O80412	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Mitochondrial phosphate transporter n=1 Tax=Glycine max RepID=O80412_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma16g05460

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma16g05460 not represented in the dataset	Glyma16g05460 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma16g05460

Paralog	Evidence	Comments
Glyma19g27380	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma16g05460 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.16g050100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma16g05460

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma16g05460

Limit To All Plant Sequences

>Glyma16g05460.1   sequence type=CDS   gene model=Glyma16g05460   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTCTCCCCGACTCTTCTTCCCGCCGCAACTCCCTGATCCCCTCTTTCATCTACTCCTCTTCCTCCAAAACGCTCCCTCTACACCACATGCTCAACTCCGCCTCCGCCGCCGCCCCCTCCCCGCCGCCGGAAAACCTCCACGCCGGATCGCGCGGCCTCGTGATTCCCTCTCCCAGCGAGTCACGCAAGATCAAGATTCCCAAGATGTACTCCCTCGAGTTCTACGCCGCCTGCGCCAAAGGTGGAATCCTCAGCTGTGGCCTCACTCACTTGGCCTTCACTCCTCTTGAAATAGTCAGGTGTAATATGCAGGGGCTTAAGGAGCAGGGATTCAGGGCCTTTTTCCGTGGCTGGGTGCCTACCTTGCTTGGTTACAGTGCCCAGGGTGCTTGCAAATTTGGCTTCTATGAGTTCTTTAAGAAGTACTATTCTGATATTGCTGGCCCAGAGTATGCAAGCAAGTACAAGACCTTGATCTACCTTGCTGGTTCAGCATCTGCTGAGGTTATTGCTGATATTGCTCTTTGCCCATTTGAGGCTGTGAAGGTCCGTGTCCAAACTCAGCCAGGTTTTGCAAGGGGTTTGTCTGATGGGCTCCCAAAATTTGTCAGATCCGAAGGAACCTTAGGGCTGTACAAGGGATTAGTGCCTCTATGGGGACGACAGATTCCATACACAATGATGAAGTTTGCTTCGTTTGAGACCATTGTTGAGCTGATCTATAAGCACGCCATCCCAACACCAAAGAATGAGTGCACCAAAGGCCTGCAACTTGCTGTCAGTTTTGCTGCTGGAAATATTGCTGGTGTACTTTGTGCAATTGTGTCTCATCCTGCTGATAATCTTGTCTCTTTTCTGAACAATGCAAAAGGAGCAACAGTTGGTGATGCGGTGAAGAAGCTTGGCCTGTGGGATCTCTTTACCCGTGGTCTTCTCTTCCGTATTGTTATGATTGGAACTCTTACTGGAGACCAATGGGTTATATATGATGCATTGAAATTGTTTGCCGGATTGCCAACCACTGGTGGTCCTGCTCCTGCAGCTGCTCTAGCTTCTGATGCTGAGCTTGCAAAGGCATAG

Predicted protein sequences of Glyma16g05460

Limit To All Plant Sequences

>Glyma16g05460.1   sequence type=predicted peptide   gene model=Glyma16g05460   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MALPDSSSRRNSLIPSFIYSSSSKTLPLHHMLNSASAAAPSPPPENLHAGSRGLVIPSPSESRKIKIPKMYSLEFYAACAKGGILSCGLTHLAFTPLEIVRCNMQGLKEQGFRAFFRGWVPTLLGYSAQGACKFGFYEFFKKYYSDIAGPEYASKYKTLIYLAGSASAEVIADIALCPFEAVKVRVQTQPGFARGLSDGLPKFVRSEGTLGLYKGLVPLWGRQIPYTMMKFASFETIVELIYKHAIPTPKNECTKGLQLAVSFAAGNIAGVLCAIVSHPADNLVSFLNNAKGATVGDAVKKLGLWDLFTRGLLFRIVMIGTLTGDQWVIYDALKLFAGLPTTGGPAPAAALASDAELAKA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain