SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma16g05421

Feature Type:gene_model
Chromosome:Gm16
Start:4748765
stop:4749609
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma16g05421
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G12845AT Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: endomembrane system; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; Has 8 Blast hits to 8 proteins in 4 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 8; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr1:4379023-4379382 REVERSE LENGTH=119 SoyBaseE_val: 4.00E-12ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_I1N7Z8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1N7Z8_SOYBN SoyBaseE_val: 5.00E-41ISS
UniRef100_Q9LPW5UniRef Annotation by Michelle Graham. Most informative UniRef hit: F13K23.10 protein n=2 Tax=Arabidopsis thaliana RepID=Q9LPW5_ARATH SoyBaseE_val: 3.00E-08ISS

Expression Patterns of Glyma16g05421
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma16g05421 not represented in the dataset
Glyma16g05421 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma16g05421
ParalogEvidenceComments
Glyma19g27440 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma16g05421 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.16g049700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma16g05421
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma16g05421
>Glyma16g05421.1   sequence type=CDS   gene model=Glyma16g05421   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACTGCTACTATGATCAAGTTATATTTTTTTTCCCTTGCCATTTTGGTTATCTTCCTTGCCAATCCAAAGGGTGTGACTTCAAGTTCAAGTACCAGTGAGCCTACAATTTCAGCATCTCCTGGTGTTTTGCCTTATGTGACTACCCCAGAGATTTCCTCATTTTTTCCCACTCCAAGTGCAATTCAACCAATGAGTTCTGGTTTTGAGGCCGAGGCACCGGCACCGGCACCCAGTTCAGGGGAGTTTGAGGGCAAGAGGTCTTCTGGTTCAGCTAGGTTGGATTGTGCAGGTGCCATTGTTGGTGTTCTGCTCTGTTGTGCCTTGTTAAGTAGCATAGTTGTTGTTTGA
Predicted protein sequences of Glyma16g05421
>Glyma16g05421.1   sequence type=predicted peptide   gene model=Glyma16g05421   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTATMIKLYFFSLAILVIFLANPKGVTSSSSTSEPTISASPGVLPYVTTPEISSFFPTPSAIQPMSSGFEAEAPAPAPSSGEFEGKRSSGSARLDCAGAIVGVLLCCALLSSIVVV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo