Warning : Undefined variable $sxsome in
/var/www/html/include/SeqFeatClass.php on line
665
Warning : Undefined variable $sstart in
/var/www/html/include/SeqFeatClass.php on line
665
Warning : Undefined variable $send in
/var/www/html/include/SeqFeatClass.php on line
665
Warning : get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in
/var/www/html/include/SeqFeatClass.php on line
1018
Warning : get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma16g05214): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in
/var/www/html/include/SeqFeatClass.php on line
1018
Warning : Trying to access array offset on false in
/var/www/html/include/SeqFeatClass.php on line
1019
Warning : get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in
/var/www/html/include/SeqFeatClass.php on line
1020
Warning : get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma16g05214): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in
/var/www/html/include/SeqFeatClass.php on line
1020
Warning : Trying to access array offset on false in
/var/www/html/include/SeqFeatClass.php on line
1021
Deprecated : preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in
/var/www/html/include/SeqFeatClass.php on line
1025
Deprecated : preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in
/var/www/html/include/SeqFeatClass.php on line
1031
Report for Sequence Feature Glyma16g05214
Feature Type: gene_model
Chromosome: Gm16
Start: 4523355
stop: 4528317
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma16g05214
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G13960 AT
Annotation by Michelle Graham. TAIR10: SU(VAR)3-9 homolog 4 | chr5:4501688-4505979 FORWARD LENGTH=624
SoyBase E_val: 2.00E-126 ISS
GO:0000085 GO-bp
Annotation by Michelle Graham. GO Biological Process: G2 phase of mitotic cell cycle
SoyBase N/A ISS
GO:0000226 GO-bp
Annotation by Michelle Graham. GO Biological Process: microtubule cytoskeleton organization
SoyBase N/A ISS
GO:0000911 GO-bp
Annotation by Michelle Graham. GO Biological Process: cytokinesis by cell plate formation
SoyBase N/A ISS
GO:0006260 GO-bp
Annotation by Michelle Graham. GO Biological Process: DNA replication
SoyBase N/A ISS
GO:0006270 GO-bp
Annotation by Michelle Graham. GO Biological Process: DNA replication initiation
SoyBase N/A ISS
GO:0006275 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of DNA replication
SoyBase N/A ISS
GO:0006306 GO-bp
Annotation by Michelle Graham. GO Biological Process: DNA methylation
SoyBase N/A ISS
GO:0006342 GO-bp
Annotation by Michelle Graham. GO Biological Process: chromatin silencing
SoyBase N/A ISS
GO:0006346 GO-bp
Annotation by Michelle Graham. GO Biological Process: methylation-dependent chromatin silencing
SoyBase N/A ISS
GO:0007267 GO-bp
Annotation by Michelle Graham. GO Biological Process: cell-cell signaling
SoyBase N/A ISS
GO:0008283 GO-bp
Annotation by Michelle Graham. GO Biological Process: cell proliferation
SoyBase N/A ISS
GO:0009616 GO-bp
Annotation by Michelle Graham. GO Biological Process: virus induced gene silencing
SoyBase N/A ISS
GO:0009640 GO-bp
Annotation by Michelle Graham. GO Biological Process: photomorphogenesis
SoyBase N/A ISS
GO:0009855 GO-bp
Annotation by Michelle Graham. GO Biological Process: determination of bilateral symmetry
SoyBase N/A ISS
GO:0010014 GO-bp
Annotation by Michelle Graham. GO Biological Process: meristem initiation
SoyBase N/A ISS
GO:0010073 GO-bp
Annotation by Michelle Graham. GO Biological Process: meristem maintenance
SoyBase N/A ISS
GO:0010216 GO-bp
Annotation by Michelle Graham. GO Biological Process: maintenance of DNA methylation
SoyBase N/A ISS
GO:0010267 GO-bp
Annotation by Michelle Graham. GO Biological Process: production of ta-siRNAs involved in RNA interference
SoyBase N/A ISS
GO:0016567 GO-bp
Annotation by Michelle Graham. GO Biological Process: protein ubiquitination
SoyBase N/A ISS
GO:0016571 GO-bp
Annotation by Michelle Graham. GO Biological Process: histone methylation
SoyBase N/A ISS
GO:0016572 GO-bp
Annotation by Michelle Graham. GO Biological Process: histone phosphorylation
SoyBase N/A ISS
GO:0016579 GO-bp
Annotation by Michelle Graham. GO Biological Process: protein deubiquitination
SoyBase N/A ISS
GO:0018022 GO-bp
Annotation by Michelle Graham. GO Biological Process: peptidyl-lysine methylation
SoyBase N/A ISS
GO:0031047 GO-bp
Annotation by Michelle Graham. GO Biological Process: gene silencing by RNA
SoyBase N/A ISS
GO:0031048 GO-bp
Annotation by Michelle Graham. GO Biological Process: chromatin silencing by small RNA
SoyBase N/A ISS
GO:0034968 GO-bp
Annotation by Michelle Graham. GO Biological Process: histone lysine methylation
SoyBase N/A ISS
GO:0035196 GO-bp
Annotation by Michelle Graham. GO Biological Process: production of miRNAs involved in gene silencing by miRNA
SoyBase N/A ISS
GO:0045893 GO-bp
Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent
SoyBase N/A ISS
GO:0051567 GO-bp
Annotation by Michelle Graham. GO Biological Process: histone H3-K9 methylation
SoyBase N/A ISS
GO:0051726 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of cell cycle
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0008270 GO-mf
Annotation by Michelle Graham. GO Molecular Function: zinc ion binding
SoyBase N/A ISS
GO:0008327 GO-mf
Annotation by Michelle Graham. GO Molecular Function: methyl-CpG binding
SoyBase N/A ISS
GO:0010385 GO-mf
Annotation by Michelle Graham. GO Molecular Function: double-stranded methylated DNA binding
SoyBase N/A ISS
GO:0010428 GO-mf
Annotation by Michelle Graham. GO Molecular Function: methyl-CpNpG binding
SoyBase N/A ISS
GO:0010429 GO-mf
Annotation by Michelle Graham. GO Molecular Function: methyl-CpNpN binding
SoyBase N/A ISS
GO:0018024 GO-mf
Annotation by Michelle Graham. GO Molecular Function: histone-lysine N-methyltransferase activity
SoyBase N/A ISS
GO:0042393 GO-mf
Annotation by Michelle Graham. GO Molecular Function: histone binding
SoyBase N/A ISS
GO:0046974 GO-mf
Annotation by Michelle Graham. GO Molecular Function: histone methyltransferase activity (H3-K9 specific)
SoyBase N/A ISS
KOG1082
KOG
Histone H3 (Lys9) methyltransferase SUV39H1/Clr4, required for transcriptional silencing
JGI ISS
PTHR22884 Panther
SET DOMAIN PROTEINS
JGI ISS
PTHR22884:SF114 Panther
SUBFAMILY NOT NAMED
JGI ISS
PF00856 PFAM
SET domain
JGI ISS
PF05033 PFAM
Pre-SET motif
JGI ISS
UniRef100_G7KXA0 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH4 n=1 Tax=Medicago truncatula RepID=G7KXA0_MEDTR
SoyBase E_val: 2.00E-152 ISS
UniRef100_UPI000233BEE1 UniRef
Annotation by Michelle Graham. Best UniRef hit: UPI000233BEE1 related cluster n=1 Tax=unknown RepID=UPI000233BEE1
SoyBase E_val: 0 ISS
Expression Patterns of Glyma16g05214
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma16g05214
Paralog Evidence Comments
Glyma19g27690 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma16g05214 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
References for Glyma16g05214
Coding sequences of Glyma16g05214
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma16g05214.1 sequence type=CDS gene model=Glyma16g05214 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGGTCATAACCTTCTCCATCAAAGACTGGAAGAGCGACTTGGGAGAAACTTGATTCACCTTCCATTCTACAAGTCCAATTTCACATATTGTAAGTCACTCAAGGTTGCAAAAAATGTGAAGCTTCCCATGAATGCCACCGGATGCAAATGTGAAGGCATTTGTAATGACCCAACAAGCTGTGCATGTGCATTGCGTAATGGCTCTGATTTTCCCTATGTATCTCGGGATGGTGGCAGGTTAATTGAAGCTAAAGATGTAGTATTTGAATGTGGTCCCAAATGTGGTTGTGGTCCTGGTTGTGTGAACCGAACGTCTCAAAGAGGACTTAGATATCGTCTGGAGGTTTTCCGTACTGCCAAAAAAGGATGGGCTGTTAGATCCTGGGATTTTATACCTTCTGGAGCACCAGTTTGTGAGTACACCGGAATACTTGCTAGGGCCGAGGATATGGATAGCGTTCTAGAAAACAATTATATTTTTGAGATAGATTGCTTGCAAACTATAAAGGGGCTCGGGGGAAGAGAGCGACGATCACAGGATGGAGAGATTCCTGCAAATCTTTTGGACAAATATCATGATCAATGTTCTGAAAGTGTGCCAGAGTTTTGTATTGATGCAGGATCTACTGGAAATATTGCTAGGTTTATAAACCATTGTTGTGAGCCTAATCTGTTTGTTCAATGTGTTTTGAGCACACACGATGATTTGAGATTGGCTCGTATAATGTTGTTTGCTGCAGACAACATACCCCCTTTGCAGGAATTAACATATGACTATGGTTACGTGCTTGATAGCGTGTTGGACTCGGATGGGAAGATTAAGCAAATGCCATGCTACTGTGGAGCCTCAGTCTGCAGGAAGCGATTATTCTAA
Predicted protein sequences of Glyma16g05214
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma16g05214.1 sequence type=predicted peptide gene model=Glyma16g05214 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MGHNLLHQRLEERLGRNLIHLPFYKSNFTYCKSLKVAKNVKLPMNATGCKCEGICNDPTSCACALRNGSDFPYVSRDGGRLIEAKDVVFECGPKCGCGPGCVNRTSQRGLRYRLEVFRTAKKGWAVRSWDFIPSGAPVCEYTGILARAEDMDSVLENNYIFEIDCLQTIKGLGGRERRSQDGEIPANLLDKYHDQCSESVPEFCIDAGSTGNIARFINHCCEPNLFVQCVLSTHDDLRLARIMLFAADNIPPLQELTYDYGYVLDSVLDSDGKIKQMPCYCGASVCRKRLF*