Glyma16g05070 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma16g05070

Feature Type:	gene_model
Chromosome:	Gm16
Start:	4356828
stop:	4357535
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma16g05070

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G13910	AT	Annotation by Michelle Graham. TAIR10: Integrase-type DNA-binding superfamily protein \| chr5:4482450-4483085 REVERSE LENGTH=211	SoyBase	E_val: 4.00E-49	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0009739	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to gibberellin stimulus	SoyBase	N/A	ISS
GO:0010030	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of seed germination	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
PF00847	PFAM	AP2 domain	JGI		ISS
UniRef100_B9GYC2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: AP2/ERF domain-containing transcription factor n=1 Tax=Populus trichocarpa RepID=B9GYC2_POPTR	SoyBase	E_val: 2.00E-48	ISS
UniRef100_I1ML80	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1ML80_SOYBN	SoyBase	E_val: 7.00E-139	ISS

Expression Patterns of Glyma16g05070

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma16g05070 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.16g046300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma16g05070

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma16g05070

Limit To All Plant Sequences

>Glyma16g05070.2   sequence type=CDS   gene model=Glyma16g05070   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAATCCGCGCACGACGTCGTCGTCGAAGGCGAAGAAAAAGCAAACGACAACGACGCAGGAGTCGCCGCACCAAAGGGCATCATCATCATGGGGAGGGAGGTACCTCGGCGTGCGGCGGAGGCCGTGGGGTCGGTACGCGGCGGAGATTCGCGACCCTTCCACGAAGGAGCGGCACTGGCTCGGCACGTTCGACACCGCCGACGAGGCCGCGCTGGCGTACGACAGAGCCGCACGTGCCATGCGGGGCTCACGTGCCCGCACCAACTTCGTCTACGCCGACACCACCCCCGGCTCCTCCGTCACCCCCATCATTTCACCCGACCAACCACAACCCGACCCGGTTCTTTCATTCGACCCGTTTTCCCTCCTCGCCTTCCCCTCCGGTTCTTATTCTGCCAGCGTGGCAGCTTCTCAGTTTAGCCAACAACAACAACAACCAGATAATAATAATAATAATAATATTATTAACAATAGCAATAATAATAAAGATAGCACGATAGAGCTTCCTCCGTTGCCACCGGATATTACTAGCTCCGTGGGTTATGAAGGGTTTTACAATAATGATGGAGGGTATTATTGGGAGGAGGATGATAATTACTTGCATAATCCAATGTTTAGCACAATGCCAGCAGTGTCAGACAATGTGGCTGCAGCAGCAGGGTCGTCTCAAGTTTTTGATTTTGGAAACTCCTCTTTTTTCTTCTGA

Predicted protein sequences of Glyma16g05070

Limit To All Plant Sequences

>Glyma16g05070.2   sequence type=predicted peptide   gene model=Glyma16g05070   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNPRTTSSSKAKKKQTTTTQESPHQRASSSWGGRYLGVRRRPWGRYAAEIRDPSTKERHWLGTFDTADEAALAYDRAARAMRGSRARTNFVYADTTPGSSVTPIISPDQPQPDPVLSFDPFSLLAFPSGSYSASVAASQFSQQQQQPDNNNNNNIINNSNNNKDSTIELPPLPPDITSSVGYEGFYNNDGGYYWEEDDNYLHNPMFSTMPAVSDNVAAAAGSSQVFDFGNSSFFF*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain