Glyma16g04960 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma16g04960

Feature Type:	gene_model
Chromosome:	Gm16
Start:	4256009
stop:	4257840
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma16g04960

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G13870	AT	Annotation by Michelle Graham. TAIR10: xyloglucan endotransglucosylase/hydrolase 5 \| chr5:4475089-4476217 REVERSE LENGTH=293	SoyBase	E_val: 2.00E-178	ISS
GO:0005975	GO-bp	Annotation by Michelle Graham. GO Biological Process: carbohydrate metabolic process	SoyBase	N/A	ISS
GO:0006073	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular glucan metabolic process	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0005618	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cell wall	SoyBase	N/A	ISS
GO:0048046	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: apoplast	SoyBase	N/A	ISS
GO:0004553	GO-mf	Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, hydrolyzing O-glycosyl compounds	SoyBase	N/A	ISS
GO:0016762	GO-mf	Annotation by Michelle Graham. GO Molecular Function: xyloglucan:xyloglucosyl transferase activity	SoyBase	N/A	ISS
GO:0016798	GO-mf	Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, acting on glycosyl bonds	SoyBase	N/A	ISS
PF00722	PFAM	Glycosyl hydrolases family 16	JGI		ISS
PF06955	PFAM	Xyloglucan endo-transglycosylase (XET) C-terminus	JGI		ISS
UniRef100_C6TMX0	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TMX0_SOYBN	SoyBase	E_val: 0	ISS
UniRef100_Q8LNZ5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Probable xyloglucan endotransglucosylase/hydrolase protein B n=1 Tax=Vigna angularis RepID=XTHB_PHAAN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma16g04960

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma16g04960

Paralog	Evidence	Comments
Glyma19g28200	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma16g04960 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.16g045100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma16g04960

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma16g04960

Limit To All Plant Sequences

>Glyma16g04960.1   sequence type=CDS   gene model=Glyma16g04960   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAAATGGGTTCTTCTTTGTGGACTTTGTGTCTAATTTTGGCTTCACTAGCCTCTTCTGCATTCTGTGCCTTTCCACGGAGGCCAGTGGATGTTCCATTCGGCAGAAACTACGTTCCCACTTGGGCTTTTGATCACATCAAATACTTCAATGGAGGTTCTGAGATTCAACTTCATCTTGACAAGTACACTGGTACTGGCTTCCAGTCCAAAGGGTCATACTTGTTTGGTCACTTCAGCATGAACATAAAGATGGTTCCTGGCGATTCAGCTGGCACAGTCACTGCTTTTTATTTATCTTCTCAAAATGCGGAGCACGATGAGATAGATTTTGAGTTCTTGGGGAACAGAACAGGACAACCTTACATTTTGCAAACAAATGTGTTCACCGGAGGCAAGGGTGACAGAGAGCAAAGAATCTTTCTCTGGTTTGATCCCACAAAAGCATACCACAGATACTCTGTGCTGTGGAACATGTATCAAATTGTGTTCCTAGTGGATAACATCCCAATAAGGGTGTTCAAAAACCTAAAGGGCTTGGGAGTGAAGTTCCCCTTTGACCAACCCATGAAGGTGTACAACAGCTTGTGGAATGCTGATGACTGGGCCACAAGGGGTGGTTTGGAGAAAACAGATTGGTCCAAAGCACCCTTCATAGCAGAATACAAAGGGTTCCACGTTGATGGGTGTGAAGCTTCAGTGAATGCAAAGTTCTGTGCTACACAAGGCAAGAGGTGGTGGGATCAAGCACAGTATCATGATCTTGATGCTTCTCAATGGAGATGGCTCAGGTGGGTGCGCAGGAAATACACCATCTACAACTACTGCACTGACAGAAGCCGCTACCCTCAGCTTCCACCTGAATGTAGAAGAAACCGTGACATTTAA

Predicted protein sequences of Glyma16g04960

Limit To All Plant Sequences

>Glyma16g04960.1   sequence type=predicted peptide   gene model=Glyma16g04960   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKMGSSLWTLCLILASLASSAFCAFPRRPVDVPFGRNYVPTWAFDHIKYFNGGSEIQLHLDKYTGTGFQSKGSYLFGHFSMNIKMVPGDSAGTVTAFYLSSQNAEHDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIFLWFDPTKAYHRYSVLWNMYQIVFLVDNIPIRVFKNLKGLGVKFPFDQPMKVYNSLWNADDWATRGGLEKTDWSKAPFIAEYKGFHVDGCEASVNAKFCATQGKRWWDQAQYHDLDASQWRWLRWVRRKYTIYNYCTDRSRYPQLPPECRRNRDI*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain