Glyma16g04800 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma16g04800

Feature Type:	gene_model
Chromosome:	Gm16
Start:	4096102
stop:	4102624
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma16g04800

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G18290	AT	Annotation by Michelle Graham. TAIR10: Aquaporin-like superfamily protein \| chr5:6055198-6056407 REVERSE LENGTH=243	SoyBase	E_val: 6.00E-82	ISS
GO:0006810	GO-bp	Annotation by Michelle Graham. GO Biological Process: transport	SoyBase	N/A	ISS
GO:0046685	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to arsenic-containing substance	SoyBase	N/A	ISS
GO:0005783	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0005215	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transporter activity	SoyBase	N/A	ISS
GO:0015250	GO-mf	Annotation by Michelle Graham. GO Molecular Function: water channel activity	SoyBase	N/A	ISS
KOG0223	KOG	Aquaporin (major intrinsic protein family)	JGI		ISS
PTHR19139	Panther	AQUAPORIN TRANSPORTER	JGI		ISS
PTHR19139:SF3	Panther	MAJOR INTRINSIC PROTEIN	JGI		ISS
PF00230	PFAM	Major intrinsic protein	JGI		ISS
UniRef100_G7KYE4	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Aquaporin SIP1-2 n=1 Tax=Medicago truncatula RepID=G7KYE4_MEDTR	SoyBase	E_val: 5.00E-135	ISS
UniRef100_I1ML53	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1ML53_SOYBN	SoyBase	E_val: 3.00E-176	ISS

Expression Patterns of Glyma16g04800

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma16g04800

Paralog	Evidence	Comments
Glyma19g28430	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma16g04800 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.16g043800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma16g04800

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma16g04800

Limit To All Plant Sequences

>Glyma16g04800.1   sequence type=CDS   gene model=Glyma16g04800   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTTGGTGCTATAAAAGCAGCGATTGGAGACGCGGTGTTGACTTTCATGTGGGTGTTCTGTTCCTCTGTGTTGGGAATTGCTTCAGGGTACATAACCAATGCACTTAACCTTCAACACATAACCTACAACGGGTTCCCTTACCCTTCTTTTCTTGTCACCACCACCCTCGTTTTTGTTCTCGTTTTTCTTTTCACCATCATTGGCAATGTTCTTGGTGGGGCCAGCTTCAACCCCACCGGCACCGCTTCCTTCTATGCCGTTGGTCTTGGTTCGGATACTCTCTTCTCAATGGCGCTTCGTTTCCCTGCGCAGGCAGCTGGTGCTGCGGGCGGTGCACTGGCAATTATGGAAGTGATTCCTGCAAAGTACAGGCACATGATTGGGGGGCCTTCTTTGAAAGTGGATTTGCACACTGGGGCTGTCGCTGAAGGGGTGTTGACTTTTGTGATTACCTTTGTCGTTCTCCTCATCTTCCTCAAGGGCCCTCGTAGTGACTTGTTGAAGACTTGGTTGCTGGCCACGGCAACTGTAGTTTTGGTCATGGTTGGATCTGCCTACACTGGGCCAGCCATGAATCCTGCCAACGCTTTTGGCTGGGCATACATAAACAACTGGCACAACACATGGGACCAATTCTATGTATACTGGATTTGCCCCTTCGCCGGAGCAATATTGGCTGCTTGGCTGTTCCGCGCTGTCTTTCCACCACCATCACCACCAGAAGTTAAACAGAAGAAAGCATGA

Predicted protein sequences of Glyma16g04800

Limit To All Plant Sequences

>Glyma16g04800.1   sequence type=predicted peptide   gene model=Glyma16g04800   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVGAIKAAIGDAVLTFMWVFCSSVLGIASGYITNALNLQHITYNGFPYPSFLVTTTLVFVLVFLFTIIGNVLGGASFNPTGTASFYAVGLGSDTLFSMALRFPAQAAGAAGGALAIMEVIPAKYRHMIGGPSLKVDLHTGAVAEGVLTFVITFVVLLIFLKGPRSDLLKTWLLATATVVLVMVGSAYTGPAMNPANAFGWAYINNWHNTWDQFYVYWICPFAGAILAAWLFRAVFPPPSPPEVKQKKA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain