SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma16g04570): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma16g04570): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma16g04570

Feature Type:gene_model
Chromosome:Gm16
Start:3858780
stop:3861194
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G03920AT Annotation by Michelle Graham. TAIR10: H/ACA ribonucleoprotein complex, subunit Gar1/Naf1 protein | chr3:1009123-1010379 REVERSE LENGTH=202 SoyBaseE_val: 1.00E-61ISS
GO:0001510GO-bp Annotation by Michelle Graham. GO Biological Process: RNA methylation SoyBaseN/AISS
GO:0006364GO-bp Annotation by Michelle Graham. GO Biological Process: rRNA processing SoyBaseN/AISS
GO:0009909GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of flower development SoyBaseN/AISS
GO:0031120GO-bp Annotation by Michelle Graham. GO Biological Process: snRNA pseudouridine synthesis SoyBaseN/AISS
GO:0034968GO-bp Annotation by Michelle Graham. GO Biological Process: histone lysine methylation SoyBaseN/AISS
GO:0042254GO-bp Annotation by Michelle Graham. GO Biological Process: ribosome biogenesis SoyBaseN/AISS
GO:0042991GO-bp Annotation by Michelle Graham. GO Biological Process: transcription factor import into nucleus SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005730GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleolus SoyBaseN/AISS
GO:0009535GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane SoyBaseN/AISS
GO:0003723GO-mf Annotation by Michelle Graham. GO Molecular Function: RNA binding SoyBaseN/AISS
GO:0009982GO-mf Annotation by Michelle Graham. GO Molecular Function: pseudouridine synthase activity SoyBaseN/AISS
GO:0030515GO-mf Annotation by Michelle Graham. GO Molecular Function: snoRNA binding SoyBaseN/AISS
KOG3262 KOG H/ACA small nucleolar RNP component GAR1 JGI ISS
PTHR23237Panther NUCLEOLAR PROTEIN FAMILY A MEMBER 1 (SNORNP PROTEIN GAR1) JGI ISS
PF04410PFAM Gar1/Naf1 RNA binding region JGI ISS
UniRef100_B6TYV7UniRef Annotation by Michelle Graham. Most informative UniRef hit: H/ACA ribonucleoprotein complex subunit 1-like protein 1 n=1 Tax=Zea mays RepID=B6TYV7_MAIZE SoyBaseE_val: 8.00E-61ISS
UniRef100_I1ML28UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1ML28_SOYBN SoyBaseE_val: 2.00E-122ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma16g04570 not represented in the dataset

Glyma16g04570 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma19g28740 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.16g041400 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma16g04570.1   sequence type=CDS   gene model=Glyma16g04570   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGACCCCCGAGAGGCGGTGGACGCGGCGGCGGATTCAGAGGTGGCCGCGACGGTGGTGGTCGCGGCAGAGGTGGTTTTGGTCGCGGCGGAGGTGGTTTTGGTCGCGGCGGCGGCGGCGGATATCGTGACGAAGGACCACCCTCCGAAGTCGTAGAGGTGTCATCTTTTATGCATGCATGCGAGGGAGATGCAGTGACAAAGCTTACAAATGAGAAAGTTCCCTTTTTCAATGCTCCTATTTATCTGAAAAACATGACTCAGATTGGGAAAGTTGATGAAATATTTGGCCCCATCAATGAAGCTTACTTCTCAATTAAGATGATGGAAGGGATTGTTGCTACTTCTTATTCATCCGGCGACAAGTTTTATATTGATCCAAGGAAACTGTTGCCTCTTGCAAGATTTCTTCCACAACCCAAGGGACAATCAGCTGGTAGAGGTGGTGGTGGAGGTGGTCGTGGTGGATTTAGAGGTGGCCGTGGAGGTGGTGGTTTTCGTGGAAGGGGGGCTCCAAGGGGTGGGAGAGGTGGTCCTCCCAGGGGTGGTGGACGAGGTGGTGGTTTCAGGGGAAGGGGGAGATCATAG

>Glyma16g04570.1   sequence type=predicted peptide   gene model=Glyma16g04570   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MRPPRGGGRGGGFRGGRDGGGRGRGGFGRGGGGFGRGGGGGYRDEGPPSEVVEVSSFMHACEGDAVTKLTNEKVPFFNAPIYLKNMTQIGKVDEIFGPINEAYFSIKMMEGIVATSYSSGDKFYIDPRKLLPLARFLPQPKGQSAGRGGGGGGRGGFRGGRGGGGFRGRGAPRGGRGGPPRGGGRGGGFRGRGRS*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo