Glyma16g04471 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma16g04471

Feature Type:	gene_model
Chromosome:	Gm16
Start:	3775381
stop:	3776171
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma16g04471

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G56540	AT	Annotation by Michelle Graham. TAIR10: arabinogalactan protein 14 \| chr5:22893243-22893425 FORWARD LENGTH=60	SoyBase	E_val: 5.00E-11	ISS
GO:0048767	GO-bp	Annotation by Michelle Graham. GO Biological Process: root hair elongation	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0031225	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: anchored to membrane	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
UniRef100_I1ML14	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1ML14_SOYBN	SoyBase	E_val: 1.00E-30	ISS
UniRef100_Q9LVC0	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Arabinogalactan peptide 14 n=1 Tax=Arabidopsis thaliana RepID=AGP14_ARATH	SoyBase	E_val: 2.00E-08	ISS

Expression Patterns of Glyma16g04471

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma16g04471 not represented in the dataset	Glyma16g04471 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma16g04471

Paralog	Evidence	Comments
Glyma19g28950	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma16g04471 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.16g040400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma16g04471

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma16g04471

Limit To All Plant Sequences

>Glyma16g04471.1   sequence type=CDS   gene model=Glyma16g04471   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGGCATCAAAGATGAAGTTTTTCTTGGTTTTGGTGATTGCCATGTTGGCGATGGTAGCAACTGGGGTTTCAGCTGCTGAGGCACCTGCCCCAGGTCCTTCATCCGATGCCACCACCTTCTTTGTACCCACTGCTCTTGCTTCTCTCTTTGTTCTTGCATTTGGCCTTCTCTTCTAA

Predicted protein sequences of Glyma16g04471

Limit To All Plant Sequences

>Glyma16g04471.1   sequence type=predicted peptide   gene model=Glyma16g04471   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEASKMKFFLVLVIAMLAMVATGVSAAEAPAPGPSSDATTFFVPTALASLFVLAFGLLF*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain