Glyma16g04090 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma16g04090

Feature Type:	gene_model
Chromosome:	Gm16
Start:	3480842
stop:	3484564
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma16g04090

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G23620	AT	Annotation by Michelle Graham. TAIR10: Ribosomal protein L25/Gln-tRNA synthetase, anti-codon-binding domain \| chr4:12315016-12316659 REVERSE LENGTH=264	SoyBase	E_val: 1.00E-124	ISS
GO:0006412	GO-bp	Annotation by Michelle Graham. GO Biological Process: translation	SoyBase	N/A	ISS
GO:0006783	GO-bp	Annotation by Michelle Graham. GO Biological Process: heme biosynthetic process	SoyBase	N/A	ISS
GO:0005622	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: intracellular	SoyBase	N/A	ISS
GO:0005840	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: ribosome	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0003735	GO-mf	Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome	SoyBase	N/A	ISS
GO:0008097	GO-mf	Annotation by Michelle Graham. GO Molecular Function: 5S rRNA binding	SoyBase	N/A	ISS
GO:0008270	GO-mf	Annotation by Michelle Graham. GO Molecular Function: zinc ion binding	SoyBase	N/A	ISS
GO:0050897	GO-mf	Annotation by Michelle Graham. GO Molecular Function: cobalt ion binding	SoyBase	N/A	ISS
UniRef100_I1MKX4	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MKX4_SOYBN	SoyBase	E_val: 0	ISS
UniRef100_Q2HVB5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: 50S ribosomal protein L25 n=1 Tax=Medicago truncatula RepID=Q2HVB5_MEDTR	SoyBase	E_val: 1.00E-139	ISS

Expression Patterns of Glyma16g04090

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma16g04090

Paralog	Evidence	Comments
Glyma19g29410	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma16g04090 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.16g036900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma16g04090

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma16g04090

Limit To All Plant Sequences

>Glyma16g04090.1   sequence type=CDS   gene model=Glyma16g04090   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTATCTCCCCCGCCACCACATCCTCACCAGACTCTCCCCTTACCGCCGTCACTTCTCCCACTCCGCCGCCGCCGTCCTCCGCCCCCCGGAGCCGGAGCCCCTCACCTACCTCGACGGCTTCCCTCGCCCCGATCCCAAGCACGACGAGACCATCCTCGCCGTCCCCCGCGCCGACTCCGGCAAGAACATCTCCGCGAAGGAGCGCCGCGCAGGGCGCCTGCCGAGCATCGTGTTCGAGCAGGAAGACGGCCAGCACGGCGGCAACAAGCGCCTAATCTCCGTTCGCACCGACCAGATCAGAAAACTCGTCAACCACCTCGGCCGCTCCTTCTTCCTCTCCCGCCTCTTCCTCCTCGAAGTTCGCTCCGGCTTCGACTCCGAAAACGACGTCGTCGAGACCGTTCGCGTCTTACCCCGCGCGATTCATTTGAAAGCTGGGACGGATGCGCCGTTGAATGTGACTTTTATTAGGGCTCCGTCGGATGCTTTGTTGAAAGTTGATGTTCCTCTTGTCTTCAGAGGAGAAGATGTATCGCCTGGACTCAAGAAAGGTGCTTCTTTGAATACCATCAAAAGGACTGTCAAGTACTTATGCCCTGCTGACATTATTCCTCCATATATTGACGTTGATCTAAGTGAGTTGGATGTGGGCCAGAAGTTGGTCATGGGAGATCTCAAAGTTCATCCTGCTTTAAAACTTCTTCAGCCAAGAGATGAAGCCGTTGTTAAAATTATGGGCCAAAGAGTTTCTGAACTACAAAAGAAAAAGTAA

Predicted protein sequences of Glyma16g04090

Limit To All Plant Sequences

>Glyma16g04090.1   sequence type=predicted peptide   gene model=Glyma16g04090   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MYLPRHHILTRLSPYRRHFSHSAAAVLRPPEPEPLTYLDGFPRPDPKHDETILAVPRADSGKNISAKERRAGRLPSIVFEQEDGQHGGNKRLISVRTDQIRKLVNHLGRSFFLSRLFLLEVRSGFDSENDVVETVRVLPRAIHLKAGTDAPLNVTFIRAPSDALLKVDVPLVFRGEDVSPGLKKGASLNTIKRTVKYLCPADIIPPYIDVDLSELDVGQKLVMGDLKVHPALKLLQPRDEAVVKIMGQRVSELQKKK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain