SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma16g03930): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma16g03930): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma16g03930

Feature Type:gene_model
Chromosome:Gm16
Start:3274036
stop:3274602
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G46040AT Annotation by Michelle Graham. TAIR10: ARID/BRIGHT DNA-binding domain;ELM2 domain protein | chr2:18935684-18937807 REVERSE LENGTH=562 SoyBaseE_val: 2.00E-14ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
UniRef100_G7LAX0UniRef Annotation by Michelle Graham. Most informative UniRef hit: MYB transcription factor MYB165 n=1 Tax=Medicago truncatula RepID=G7LAX0_MEDTR SoyBaseE_val: 2.00E-28ISS
UniRef100_UPI0002338ACDUniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002338ACD related cluster n=1 Tax=unknown RepID=UPI0002338ACD SoyBaseE_val: 2.00E-62ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma16g03930 not represented in the dataset

Glyma16g03930 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma07g07525 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma16g03930.1   sequence type=CDS   gene model=Glyma16g03930   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GAAGGAGATGGAAATGGAGGGTGTCGTGATTCGGAGATGCCAGACCGTGAGGTGAATGAGTCGGAGATGCCAGACCGTGAGGTGAATGAGTCGGTGAATGGAAACTTGGGTGGGGGGAATGATGCAATGGAAGCGGGGGAAGAGTTTGATGGAGGGAAAATGTCTAAAGAGCAGGGCTTGGTGATGGATCCACCTGGTGGGGATAGTGATGATCGAAAGAGGAAGAGAGACATGTTGGATTTGTCTGATGGGGATAGTGATAGTTCTGATTGTAAGAGGATGCGAGAGTCTGCGTTGGATATGCTGAGCTGGGTTACAGGTGCTGCAAAGAATCCCTGTGATCCTGAAGTTGGTTCAATACCTGAAAAGGCAAAGTGGAAGTCTCAAAGTAATCAGGAGGTGTGGAAGCAAGTGCTGTTGTTTCGAGAGGCAGCGTTTCTCAAAAGAGGTTCTGATACAAGCAGTGAACAACGTAGCTGGCAG

>Glyma16g03930.1   sequence type=predicted peptide   gene model=Glyma16g03930   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
EGDGNGGCRDSEMPDREVNESEMPDREVNESVNGNLGGGNDAMEAGEEFDGGKMSKEQGLVMDPPGGDSDDRKRKRDMLDLSDGDSDSSDCKRMRESALDMLSWVTGAAKNPCDPEVGSIPEKAKWKSQSNQEVWKQVLLFREAAFLKRGSDTSSEQRSWQ







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo