SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma16g03640

Feature Type:gene_model
Chromosome:Gm16
Start:3057669
stop:3064025
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma16g03640
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G01280AT Annotation by Michelle Graham. TAIR10: Homeodomain-like superfamily protein | chr4:535288-536854 FORWARD LENGTH=303 SoyBaseE_val: 1.00E-108ISS
GO:0000303GO-bp Annotation by Michelle Graham. GO Biological Process: response to superoxide SoyBaseN/AISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009723GO-bp Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus SoyBaseN/AISS
GO:0009733GO-bp Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus SoyBaseN/AISS
GO:0009736GO-bp Annotation by Michelle Graham. GO Biological Process: cytokinin mediated signaling pathway SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0009739GO-bp Annotation by Michelle Graham. GO Biological Process: response to gibberellin stimulus SoyBaseN/AISS
GO:0009751GO-bp Annotation by Michelle Graham. GO Biological Process: response to salicylic acid stimulus SoyBaseN/AISS
GO:0009753GO-bp Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus SoyBaseN/AISS
GO:0009873GO-bp Annotation by Michelle Graham. GO Biological Process: ethylene mediated signaling pathway SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0048573GO-bp Annotation by Michelle Graham. GO Biological Process: photoperiodism, flowering SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
KOG0724 KOG Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains JGI ISS
PTHR12802Panther SWI/SNF COMPLEX-RELATED JGI ISS
PTHR12802:SF30Panther OS06G0105800 PROTEIN JGI ISS
PF00249PFAM Myb-like DNA-binding domain JGI ISS
UniRef100_I1MKS3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MKS3_SOYBN SoyBaseE_val: 0ISS
UniRef100_Q0PJI6UniRef Annotation by Michelle Graham. Most informative UniRef hit: MYB transcription factor MYB133 n=1 Tax=Glycine max RepID=Q0PJI6_SOYBN SoyBaseE_val: 0ISS

Expression Patterns of Glyma16g03640
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma16g03640
ParalogEvidenceComments
Glyma07g07200 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma16g03640 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.16g032600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma16g03640
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma16g03640
>Glyma16g03640.1   sequence type=CDS   gene model=Glyma16g03640   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGTCGGTGAACCCAAACCCCGCTCAAGGCTTCTACTTCTTCGATCCCTCCAACATGACCCTTCCCGGCGTCAACAATCTTCCACCGCCGCCGCCGCCGGCTCCGGCTGCTCCCTCCGCCGTCGAGGATCCGAATAAGAAGATCCGGAAACCCTACACGATTACCAAGTCCAGGGAGAGCTGGACCGAGCAGGAGCACGACAAGTTTCTAGAAGCTCTCCAATTATTTGATCGGGACTGGAAAAAGATTGAAGCATTTGTTGGTTCAAAAACAGTTATCCAGATACGAAGTCATGCACAAAAGTATTTTCTTAAAGTTCAGAAGAATGGAACAAGTGAACATGTACCTCCTCCTCGGCCAAAGAGAAAAGCTGCTCGCCCATACCCTCAAAAAGCTCCTAAAACTCCTACTGTATCCCAAGTTATGGGCCCATTGCAATCTTCATCTGCTTTCATTGAACCTGCATACATTTATAGCCCAGATTCTTCATCTGTGCTTGGAACTCCAGTTACTAACATGCCTTTATCATCTTGGAATTATAATACTACACCACAACCAGGCAATGTGCCACAAGTGACCAGAGATGACATGGGATTGACTGGAGCTGGACAAGCTGCTCCTCTTAATTGTTGCTACAGCAGTAGTAATGAGAGCACCCCTCCGACTTGGCCTCGTAGCAAAAGGATTAATCAAGGTGACCAGGGCAAGCCAATTAAAGTAATGCCAGATTTTGCACAAGTCTACAGCTTCATTGGCAGTGTATTCGATCCAAATTCAACTAATCACCTACAGAAACTACAACAGATGGACCCAATAAATGTGGAAACGGTATTGTTGTTGATGACAAATCTCTCCGTCAATTTAATGAGTCCTGAATTTGAGGATCATAAGAGGCTGCTTTCATCATATGATACCGACTCTGACAAGTCGAAGTTTGTTAATATTTGCAGCAAATCCTTCACCAATAAATCCGAGAGTGCTGTTTTGTCTGCTTAG
Predicted protein sequences of Glyma16g03640
>Glyma16g03640.1   sequence type=predicted peptide   gene model=Glyma16g03640   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVSVNPNPAQGFYFFDPSNMTLPGVNNLPPPPPPAPAAPSAVEDPNKKIRKPYTITKSRESWTEQEHDKFLEALQLFDRDWKKIEAFVGSKTVIQIRSHAQKYFLKVQKNGTSEHVPPPRPKRKAARPYPQKAPKTPTVSQVMGPLQSSSAFIEPAYIYSPDSSSVLGTPVTNMPLSSWNYNTTPQPGNVPQVTRDDMGLTGAGQAAPLNCCYSSSNESTPPTWPRSKRINQGDQGKPIKVMPDFAQVYSFIGSVFDPNSTNHLQKLQQMDPINVETVLLLMTNLSVNLMSPEFEDHKRLLSSYDTDSDKSKFVNICSKSFTNKSESAVLSA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo