Glyma16g03470 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma16g03470

Feature Type:	gene_model
Chromosome:	Gm16
Start:	2924106
stop:	2925414
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma16g03470

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G01470	AT	Annotation by Michelle Graham. TAIR10: Late embryogenesis abundant protein \| chr1:172295-172826 REVERSE LENGTH=151	SoyBase	E_val: 7.00E-73	ISS
GO:0009269	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to desiccation	SoyBase	N/A	ISS
GO:0009409	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cold	SoyBase	N/A	ISS
GO:0009414	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to water deprivation	SoyBase	N/A	ISS
GO:0009611	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to wounding	SoyBase	N/A	ISS
GO:0009644	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to high light intensity	SoyBase	N/A	ISS
GO:0009737	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus	SoyBase	N/A	ISS
GO:0009793	GO-bp	Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy	SoyBase	N/A	ISS
GO:0010286	GO-bp	Annotation by Michelle Graham. GO Biological Process: heat acclimation	SoyBase	N/A	ISS
GO:0050832	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response to fungus	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PF03168	PFAM	Late embryogenesis abundant protein	JGI		ISS
UniRef100_Q9XER5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Seed maturation protein PM22 n=1 Tax=Glycine max RepID=Q9XER5_SOYBN	SoyBase	E_val: 8.00E-104	ISS
UniRef100_Q9XER5	UniRef	Annotation by Michelle Graham. Best UniRef hit: Seed maturation protein PM22 n=1 Tax=Glycine max RepID=Q9XER5_SOYBN	SoyBase	E_val: 8.00E-104	ISS

Expression Patterns of Glyma16g03470

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma16g03470 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.16g031300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma16g03470

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma16g03470

Limit To All Plant Sequences

>Glyma16g03470.1   sequence type=CDS   gene model=Glyma16g03470   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCGCAGTTGCTGGATAAAGCCAAGAACTTCGTGTCGGAGAAGGTAAATGATATGGCCAAGCCGGAGGCGAGTGTCACTGACGTGGACTTCAAGCGCGTGAGCAAAGATAATGTCGAGTACTTGGCCAAGGTCTCTGTTCGTAACCCTTATTCAACTTCCATACCCATTTGTGAGATCAACTACTCTTTCAAAAGCGCATCCAGGGAGATAGCATCAGGGAAAATTCCAGACCCAGGATCGTTGAAGGCAAAGGACACAACAATGGTGGATGTGCCAGTTAAGGTTCCATACAGCATATTGATGAGCTTGGCAAAGGACATTGGTGCTGACTGGGACATAGACTATCAATTGGATCTTGGTCTGGTTATTGATGTTCCTGTCATTGGCATCTTCACCATTCCTCTCTCTCAGAAAGGAGAGATCAAGCTACCAACCCTCTCTACCATGTTCGCCTAA

Predicted protein sequences of Glyma16g03470

Limit To All Plant Sequences

>Glyma16g03470.1   sequence type=predicted peptide   gene model=Glyma16g03470   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSQLLDKAKNFVSEKVNDMAKPEASVTDVDFKRVSKDNVEYLAKVSVRNPYSTSIPICEINYSFKSASREIASGKIPDPGSLKAKDTTMVDVPVKVPYSILMSLAKDIGADWDIDYQLDLGLVIDVPVIGIFTIPLSQKGEIKLPTLSTMFA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain