Glyma16g03440 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma16g03440

Feature Type:	gene_model
Chromosome:	Gm16
Start:	2909371
stop:	2910448
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma16g03440

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G46150	AT	Annotation by Michelle Graham. TAIR10: Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family \| chr2:18961424-18962089 FORWARD LENGTH=221	SoyBase	E_val: 2.00E-64	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PF03168	PFAM	Late embryogenesis abundant protein	JGI		ISS
UniRef100_I1MKQ6	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MKQ6_SOYBN	SoyBase	E_val: 7.00E-158	ISS
UniRef100_Q19QU4	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Plant cell wall protein SlTFR88 n=1 Tax=Solanum lycopersicum RepID=Q19QU4_SOLLC	SoyBase	E_val: 1.00E-79	ISS

Expression Patterns of Glyma16g03440

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma16g03440 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.16g031000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma16g03440

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma16g03440

Limit To All Plant Sequences

>Glyma16g03440.1   sequence type=CDS   gene model=Glyma16g03440   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTAGAGACGGAGCAAGCAAGACCATTAGCCCCATCAATAGAGCGCCAAAGCAGCGATGAGGATAACACCACTCCACACCCTCAAACACAAGGCCACAAAAAACTCATCAAACGTTGTGCTTGCCCATTAATCTCTTTACTTCTCATAGCAATAGTGATCATAGTTTTAATCTTCACAGTATTTCGTGTCAAGGACCCCGTGATCACAATGAACAGCATCAAGATCACAAAGCTCCAACTTGTCAACACCATGTCACAACAACCCGGGGCCAACATGTCCTTAGTCGCTGACGTGTCGGTGAAGAACCCTAACGTTGCATCCTTTAGGTATAGCAACACCACCACGAGTTTGTACTACCATGGTGTCATTGTGGGGGAGGCTAGAGGACCACCTGGGAGGGCCAAGGCCAGAAGAACATTGAGGATGAATGTCACAATTGATGTCATCACCGCTCGCGTCATTTCTAGCCCGGATTTTGTGACGGATTTAGGTTCCGGGTTGTTGACTATGAGCAGCTTCTCTAGAGTTCCTGGGCAGGTCAAGATCTTGAACTTGATTAAGAGACATGTTGTTGTGAAAATGAATTGCACCACCACTTTTAATATTTCCACACAGGCGATTAAGGAGCAAAGTTGTAAGCGGAAGGTTAAACTTTAG

Predicted protein sequences of Glyma16g03440

Limit To All Plant Sequences

>Glyma16g03440.1   sequence type=predicted peptide   gene model=Glyma16g03440   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLETEQARPLAPSIERQSSDEDNTTPHPQTQGHKKLIKRCACPLISLLLIAIVIIVLIFTVFRVKDPVITMNSIKITKLQLVNTMSQQPGANMSLVADVSVKNPNVASFRYSNTTTSLYYHGVIVGEARGPPGRAKARRTLRMNVTIDVITARVISSPDFVTDLGSGLLTMSSFSRVPGQVKILNLIKRHVVVKMNCTTTFNISTQAIKEQSCKRKVKL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain