SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma16g02940): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma16g02940): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma16g02940

Feature Type:gene_model
Chromosome:Gm16
Start:2517398
stop:2523318
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma16g02940
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G01050AT Annotation by Michelle Graham. TAIR10: thylakoid rhodanese-like | chr4:455874-458175 FORWARD LENGTH=466 SoyBaseE_val: 3.00E-151ISS
GO:0000096GO-bp Annotation by Michelle Graham. GO Biological Process: sulfur amino acid metabolic process SoyBaseN/AISS
GO:0000165GO-bp Annotation by Michelle Graham. GO Biological Process: MAPK cascade SoyBaseN/AISS
GO:0006364GO-bp Annotation by Michelle Graham. GO Biological Process: rRNA processing SoyBaseN/AISS
GO:0006546GO-bp Annotation by Michelle Graham. GO Biological Process: glycine catabolic process SoyBaseN/AISS
GO:0006612GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane SoyBaseN/AISS
GO:0006636GO-bp Annotation by Michelle Graham. GO Biological Process: unsaturated fatty acid biosynthetic process SoyBaseN/AISS
GO:0006733GO-bp Annotation by Michelle Graham. GO Biological Process: oxidoreduction coenzyme metabolic process SoyBaseN/AISS
GO:0006766GO-bp Annotation by Michelle Graham. GO Biological Process: vitamin metabolic process SoyBaseN/AISS
GO:0008652GO-bp Annotation by Michelle Graham. GO Biological Process: cellular amino acid biosynthetic process SoyBaseN/AISS
GO:0009072GO-bp Annotation by Michelle Graham. GO Biological Process: aromatic amino acid family metabolic process SoyBaseN/AISS
GO:0009106GO-bp Annotation by Michelle Graham. GO Biological Process: lipoate metabolic process SoyBaseN/AISS
GO:0009108GO-bp Annotation by Michelle Graham. GO Biological Process: coenzyme biosynthetic process SoyBaseN/AISS
GO:0009117GO-bp Annotation by Michelle Graham. GO Biological Process: nucleotide metabolic process SoyBaseN/AISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009416GO-bp Annotation by Michelle Graham. GO Biological Process: response to light stimulus SoyBaseN/AISS
GO:0009595GO-bp Annotation by Michelle Graham. GO Biological Process: detection of biotic stimulus SoyBaseN/AISS
GO:0009637GO-bp Annotation by Michelle Graham. GO Biological Process: response to blue light SoyBaseN/AISS
GO:0009657GO-bp Annotation by Michelle Graham. GO Biological Process: plastid organization SoyBaseN/AISS
GO:0009695GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid biosynthetic process SoyBaseN/AISS
GO:0009697GO-bp Annotation by Michelle Graham. GO Biological Process: salicylic acid biosynthetic process SoyBaseN/AISS
GO:0009744GO-bp Annotation by Michelle Graham. GO Biological Process: response to sucrose stimulus SoyBaseN/AISS
GO:0009749GO-bp Annotation by Michelle Graham. GO Biological Process: response to glucose stimulus SoyBaseN/AISS
GO:0009772GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthetic electron transport in photosystem II SoyBaseN/AISS
GO:0009773GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthetic electron transport in photosystem I SoyBaseN/AISS
GO:0009814GO-bp Annotation by Michelle Graham. GO Biological Process: defense response, incompatible interaction SoyBaseN/AISS
GO:0009862GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0009867GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway SoyBaseN/AISS
GO:0009902GO-bp Annotation by Michelle Graham. GO Biological Process: chloroplast relocation SoyBaseN/AISS
GO:0010027GO-bp Annotation by Michelle Graham. GO Biological Process: thylakoid membrane organization SoyBaseN/AISS
GO:0010114GO-bp Annotation by Michelle Graham. GO Biological Process: response to red light SoyBaseN/AISS
GO:0010200GO-bp Annotation by Michelle Graham. GO Biological Process: response to chitin SoyBaseN/AISS
GO:0010207GO-bp Annotation by Michelle Graham. GO Biological Process: photosystem II assembly SoyBaseN/AISS
GO:0010218GO-bp Annotation by Michelle Graham. GO Biological Process: response to far red light SoyBaseN/AISS
GO:0010310GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of hydrogen peroxide metabolic process SoyBaseN/AISS
GO:0010363GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response SoyBaseN/AISS
GO:0015979GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis SoyBaseN/AISS
GO:0015994GO-bp Annotation by Michelle Graham. GO Biological Process: chlorophyll metabolic process SoyBaseN/AISS
GO:0015995GO-bp Annotation by Michelle Graham. GO Biological Process: chlorophyll biosynthetic process SoyBaseN/AISS
GO:0019216GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of lipid metabolic process SoyBaseN/AISS
GO:0019288GO-bp Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway SoyBaseN/AISS
GO:0019344GO-bp Annotation by Michelle Graham. GO Biological Process: cysteine biosynthetic process SoyBaseN/AISS
GO:0019684GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction SoyBaseN/AISS
GO:0019748GO-bp Annotation by Michelle Graham. GO Biological Process: secondary metabolic process SoyBaseN/AISS
GO:0031348GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response SoyBaseN/AISS
GO:0031408GO-bp Annotation by Michelle Graham. GO Biological Process: oxylipin biosynthetic process SoyBaseN/AISS
GO:0034660GO-bp Annotation by Michelle Graham. GO Biological Process: ncRNA metabolic process SoyBaseN/AISS
GO:0035304GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of protein dephosphorylation SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0043900GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of multi-organism process SoyBaseN/AISS
GO:0044272GO-bp Annotation by Michelle Graham. GO Biological Process: sulfur compound biosynthetic process SoyBaseN/AISS
GO:0050832GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to fungus SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009534GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid SoyBaseN/AISS
GO:0009535GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
PTHR11177Panther CHITINASE JGI ISS
PTHR11177:SF3Panther CHITINASE-RELATED JGI ISS
UniRef100_I1MKL0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MKL0_SOYBN SoyBaseE_val: 0ISS
UniRef100_Q9M158UniRef Annotation by Michelle Graham. Most informative UniRef hit: Rhodanese-like domain-containing protein 4, chloroplastic n=1 Tax=Arabidopsis thaliana RepID=STR4_ARATH SoyBaseE_val: 1.00E-148ISS

Expression Patterns of Glyma16g02940
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma16g02940 not represented in the dataset
Glyma16g02940 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma16g02940
ParalogEvidenceComments
Glyma07g06300 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma16g02940 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.16g026200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma16g02940
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma16g02940
>Glyma16g02940.1   sequence type=CDS   gene model=Glyma16g02940   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGGCCCTCAATGCTGCTGGCTTGACCCCTCTATCTGTGCTCTCTGATGCAAAAACAACAAGAACTAAACACCCTTCTGTTTCTGTATGCAAAGTCTCAAACTTTTCCACCTCCACCAACAAAAAACAAACCTTGCTGCAAAGTTGCATATCAAAAACTTTGCATGGGGGGCTGATTCTTGCAGCTTCCGTTGTAAATGGTGGAGCTGCCACAGCTTTAACGTACGATGAAGCCCTGGGACAACCTTTGAGCCTCCCTGGTGCTGGGGACTTTGATGTGAACGGTTTTGTGGAGAGTGTCACTGGCTTTGCAGCTGAAAACCCTGCAATTCTTGCTGGGGGAGTAGCTGTTTTGGCAGTGCCATTGGTTTTGTCTCAGGTTCTTTTCAAGAAGCCTAAGGCTTGGGGTGTTGAGTCTGCCAAGAATGCTTATGCAAAACTTGGTGCTGATGGGAATGCTCAGTTGCTTGATATAAGGGCACTGGTGGAGATTAGGCAAGTGGGGTCCCCAGATGTTGGGGGTCTGAAGAAGAAAGCAGTGTCAATACCTTATAAGGGTGATGATAAGCCAGGGTTCTTGAAGAAGCTTGCTTTGAAGTTTAAGGAGCCAGAGAATACCACATTGTTTATTCTGGACAAATTTGATGGGAACTCTGAACTGGTTGCAGAGTTGGTTACCGTTAATGGGTTTAAAGCAGCTTATGCGATTAAGGATGGTGCAGAAGGACCGCGAGGATGGAAGAGTAGTGGTCTTCCTTGGATAGAACCACGGAAAACATTGAGTTTTGACAATCTGACAGATGCTATATCTGAAGCAATAGGAGATACCACTGATGGCGTGGCAGTTACTCTTGGGGTTGCTGCAGCTGCTGCTGGACTTAGTCTATTAGCTTTTTCTGAGATAGAATCAATCCTCCAGGTTGTTGGATCAGCTGCGCTCATTCAGTTTGCAAGCAAGAAGCTTTTGTTTGCTGAGGACCGAGAGCAAACCGTGAAACAACTTGGTGAGTTCTTGAACACCAAGGTTGCCCCCAAAGAACTTGTTGATGAAATAAAGGATATTGGAAAGGCTCTTCTACCATCCTCTACCGATAATAAGGCTCTTCCTGCTCCGGCAGAGAAAAGTTCAGAGCTTGCTACAGCTGATAGCACTGTACAGAGAGCAGTAGCTACTCCCGAGTCCAAAGCTGAAGCAGTAGCAACTCCCGAGCCCAAAGTGGATGCAGTAGCTCCTGAAGTAAACTCTGTGCCCAAAACTGAAGTCAAGGCAGAAGAATCACTTCCTGTGCAACCAAGGCCACTTTCACCATACCCATATTATCCAGATTTCAAGCCTCCAACATCTCCTACCCCTTCACAGCCCTAG
Predicted protein sequences of Glyma16g02940
>Glyma16g02940.1   sequence type=predicted peptide   gene model=Glyma16g02940   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEALNAAGLTPLSVLSDAKTTRTKHPSVSVCKVSNFSTSTNKKQTLLQSCISKTLHGGLILAASVVNGGAATALTYDEALGQPLSLPGAGDFDVNGFVESVTGFAAENPAILAGGVAVLAVPLVLSQVLFKKPKAWGVESAKNAYAKLGADGNAQLLDIRALVEIRQVGSPDVGGLKKKAVSIPYKGDDKPGFLKKLALKFKEPENTTLFILDKFDGNSELVAELVTVNGFKAAYAIKDGAEGPRGWKSSGLPWIEPRKTLSFDNLTDAISEAIGDTTDGVAVTLGVAAAAAGLSLLAFSEIESILQVVGSAALIQFASKKLLFAEDREQTVKQLGEFLNTKVAPKELVDEIKDIGKALLPSSTDNKALPAPAEKSSELATADSTVQRAVATPESKAEAVATPEPKVDAVAPEVNSVPKTEVKAEESLPVQPRPLSPYPYYPDFKPPTSPTPSQP*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo