SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma16g02680): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma16g02680): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma16g02680

Feature Type:gene_model
Chromosome:Gm16
Start:2278308
stop:2279611
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G01250AT Annotation by Michelle Graham. TAIR10: Integrase-type DNA-binding superfamily protein | chr1:104731-105309 REVERSE LENGTH=192 SoyBaseE_val: 4.00E-47ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009414GO-bp Annotation by Michelle Graham. GO Biological Process: response to water deprivation SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
PF00847PFAM AP2 domain JGI ISS
UniRef100_A9PL82UniRef Annotation by Michelle Graham. Most informative UniRef hit: AP2/ERF domain-containing transcription factor n=2 Tax=Populus RepID=A9PL82_POPTR SoyBaseE_val: 9.00E-59ISS
UniRef100_UPI000189D0DEUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000189D0DE related cluster n=1 Tax=unknown RepID=UPI000189D0DE SoyBaseE_val: 2.00E-140ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma16g02680 not represented in the dataset

Glyma16g02680 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma07g06080 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.16g023800 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma16g02680.1   sequence type=CDS   gene model=Glyma16g02680   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGCAAGAGCTTCAACGCAACAGTGTCCACGACGACGAAGCCGCCACCACCACGAGCTCCGGCGACAAGCCCGCCACCCCTCGCGGCGGCGGAACCCGACACCCCCTCTTCCGCGGCGTTCGCAAGCGCCGCTGGGGCAAATGGGTCTCCGAAATCCGGGAGCCGAGGAAAAAGTCACGCATATGGCTCGGCTCCTTCCCGGCGCCGGAGATGGCGGCCAAGGCCTACGACGTCGCCGCCTACTGCCTCAAGGGCCGCAAGGCGCAGCTCAACTTCCCCGACGAGGTCCACCGTCTTCCGCTGCTCCCCTCCGCCTGCACCGCCCGCGACATCCAGGCCGCCGCCGCCAAGGCCGCCCACATGATGATAGTCCAGGCCGCCTCTGTCACCGCCGACTCGCCGGAGAAAAGCAGCAGCATTACCTCCGACTGCGGCGACGGTGGCGGTGGAGACGACTTCTGGGGCGAAATTGAGCTGCCAGAGTTGCTCAACGCCAAGTGGTGGGCCTCCGACCACGACGTCACGCCGTGGCCCGAGTCCGAGCTCCCGCCCCAGCAGCCCTTCACCACGGCGTGCTTGTAG

>Glyma16g02680.1   sequence type=predicted peptide   gene model=Glyma16g02680   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEQELQRNSVHDDEAATTTSSGDKPATPRGGGTRHPLFRGVRKRRWGKWVSEIREPRKKSRIWLGSFPAPEMAAKAYDVAAYCLKGRKAQLNFPDEVHRLPLLPSACTARDIQAAAAKAAHMMIVQAASVTADSPEKSSSITSDCGDGGGGDDFWGEIELPELLNAKWWASDHDVTPWPESELPPQQPFTTACL*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo