Report for Sequence Feature Glyma16g02570
Feature Type: gene_model
Chromosome: Gm16
Start: 2157828
stop: 2159316
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma16g02570
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G49330 AT
Annotation by Michelle Graham. TAIR10: myb domain protein 111 | chr5:19999147-20001293 REVERSE LENGTH=342
SoyBase E_val: 6.00E-64 ISS
GO:0006355 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent
SoyBase N/A ISS
GO:0051555 GO-bp
Annotation by Michelle Graham. GO Biological Process: flavonol biosynthetic process
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0003677 GO-mf
Annotation by Michelle Graham. GO Molecular Function: DNA binding
SoyBase N/A ISS
GO:0003700 GO-mf
Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity
SoyBase N/A ISS
KOG0048
KOG
Transcription factor, Myb superfamily
JGI ISS
PTHR10641 Panther
MYB-RELATED
JGI ISS
PF00249 PFAM
Myb-like DNA-binding domain
JGI ISS
UniRef100_Q0PJJ9 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: MYB transcription factor MYB92 n=2 Tax=Glycine max RepID=Q0PJJ9_SOYBN
SoyBase E_val: 0 ISS
UniRef100_Q0PJJ9 UniRef
Annotation by Michelle Graham. Best UniRef hit: MYB transcription factor MYB92 n=2 Tax=Glycine max RepID=Q0PJJ9_SOYBN
SoyBase E_val: 0 ISS
Expression Patterns of Glyma16g02570
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma16g02570
Paralog Evidence Comments
Glyma07g05960 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma16g02570 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.16g023000 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma16g02570
Coding sequences of Glyma16g02570
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma16g02570.1 sequence type=CDS gene model=Glyma16g02570 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGGAAGGGCTCCTTGTTGTTCCAAAGTGGGGTTGCACAAAGGTCCATGGACTCCTAAAGAAGATGCATTGCTTACCAAGTATATCCAAGCTCATGGAGAAGGCCAATGGAAATCACTACCCAAAAAAGCAGGGCTTCTTAGATGTGGAAAAAGTTGTAGATTGAGATGGATGAACTATCTGAGACCAGACATAAAGAGAGGGAACATAGCACCAGAAGAAGATGATCTTATAATCAGAATGCATTCACTTTTGGGAAACAGATGGTCCCTCATAGCAGGAAGGTTACCAGGGAGAACAGACAATGAAATAAAGAACTACTGGAACACCCATCTAAGCAAAAAGCTGAAAATTCAAGGAACAGAAGACACAGACACACACAAAATGTTAGAGAATCCTCAAGAAGAGGCTGCAAGTGATGGTGGCAACAACAACAAAAAGAAGAAGAAGAAGAAGAACGGTGGCAAAAAGAACAAGCAGAAGAACAAAGGCAAAGAAAATGATGAGCCGCCAAAGACACAAGTTTACCTACCAAAACCAATTAGAGTGAAGGCAATGTATTTACAAAGAACGGATAGTAACACCTTCACCTTTGATTCCAATTCAGCTAGTGGATCAACAAGCCAAGAGAAGGAGGAAAGCCCCGTGACAAAAGAATCAAACGTGGTTAGTGAAGTTGGTAATGTGGGAGAAGAAAGTGATGGTTTTGGCTTCTTCAGTGAGGACCATGACTTAGTCAACGTCTCAGATATTGAATGCCACTCTTATTTTCCCACAGATCATGGCAACCTACAGCAATTGTATGAAGAATATTTCCAGCTCTTGAACATGGACCATGGCCAATTCGAACTGAATTCATTTGCAGAATCTTTATTAGATTAA
Predicted protein sequences of Glyma16g02570
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma16g02570.1 sequence type=predicted peptide gene model=Glyma16g02570 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MGRAPCCSKVGLHKGPWTPKEDALLTKYIQAHGEGQWKSLPKKAGLLRCGKSCRLRWMNYLRPDIKRGNIAPEEDDLIIRMHSLLGNRWSLIAGRLPGRTDNEIKNYWNTHLSKKLKIQGTEDTDTHKMLENPQEEAASDGGNNNKKKKKKKNGGKKNKQKNKGKENDEPPKTQVYLPKPIRVKAMYLQRTDSNTFTFDSNSASGSTSQEKEESPVTKESNVVSEVGNVGEESDGFGFFSEDHDLVNVSDIECHSYFPTDHGNLQQLYEEYFQLLNMDHGQFELNSFAESLLD*