SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma16g00480): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma16g00480): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma16g00480

Feature Type:gene_model
Chromosome:Gm16
Start:169598
stop:172510
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G09800AT Annotation by Michelle Graham. TAIR10: Pseudouridine synthase family protein | chr1:3177121-3180336 REVERSE LENGTH=372 SoyBaseE_val: 4.00E-174ISS
GO:0001522GO-bp Annotation by Michelle Graham. GO Biological Process: pseudouridine synthesis SoyBaseN/AISS
GO:0009451GO-bp Annotation by Michelle Graham. GO Biological Process: RNA modification SoyBaseN/AISS
GO:0019243GO-bp Annotation by Michelle Graham. GO Biological Process: methylglyoxal catabolic process to D-lactate SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003723GO-mf Annotation by Michelle Graham. GO Molecular Function: RNA binding SoyBaseN/AISS
GO:0009982GO-mf Annotation by Michelle Graham. GO Molecular Function: pseudouridine synthase activity SoyBaseN/AISS
KOG4393 KOG Predicted pseudouridylate synthase JGI ISS
PTHR11142Panther PSEUDOURIDYLATE SYNTHASE JGI ISS
PF01416PFAM tRNA pseudouridine synthase JGI ISS
UniRef100_I1MJV5UniRef Annotation by Michelle Graham. Best UniRef hit: tRNA pseudouridine synthase A 5 n=1 Tax=Glycine max RepID=I1MJV5_SOYBN SoyBaseE_val: 0ISS
UniRef100_I1MJV5UniRef Annotation by Michelle Graham. Most informative UniRef hit: tRNA pseudouridine synthase A 5 n=1 Tax=Glycine max RepID=I1MJV5_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma16g00480 not represented in the dataset

Glyma16g00480 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma12g28832 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.16g003100 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma16g00480.1   sequence type=CDS   gene model=Glyma16g00480   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACAGAGAATCTGAAGCATACGGTGGATTTGGAATGCAGTGATAATAACATTAATAGGCCGTCAAAGATATCAATAATCGAGTATCCCATTGACAGTGACATTGACGAAGAAGAAGAAATGATCAAAAACCCTAGGAATGGCATTCAACGCTATTTGGTTGCTATCGAGTATATTGGGACTCGCTTCTCCGGTTCTCAGAAGCAGCTCAATGTCCGCACCGTCGTCGGGGTTCTTGAGGAAGCTTTTTCTAAATTTGTTGGCCAACCAGTCTCTGTGTCTTGTTCAAGTCGAACTGACGCTGGAGTGCATGCCTTGTCAAATGTTTGTCATGTCGATATTCAACGCATCAGCAAAAGGAGGCCTGGTGAAGTGTTAACTCCTCATGAACCTGCTGTCGTTGGAAGAGCTGTAAACCATTTCTTACAGAAGCAAGACAGTGACTTAATGGTTATTGATGTTCGATGTGTTCCATCTGATTTTCATGCAAGATTTAAAGCACAAGAGCGCATATACTTCTATCGGTTGCTGTCTGGGCCAGAGCCTTTGTCGACCTTCGAGAAAGATCGAGCATGGCATGTACCTGAGGAGCTTAGTCTTCCAGCTATGCAAGAAGCATGCAGAGTTCTTGTTGGATTCCATGATTTTAGTTCCTTCAGGGCAGCTGGTTGTCAGGCAAAGTCACCAATTAGAACTCTGGATGAACTCAGTGTCAATGAGGTAATTGAAAGTCCATATTTTCCATCTCTAATGGATAGAGAACAACATAATAAAGTCAGTGGTGATCTTCGTAGCTGCCCCAACAACTCTGAAACTGACATTCCTCCTACTTCTAATCCTAGCATTGATAAAGTAATGGCATCAAGTCAAGATGTAGGATTTGGCAAAAGAAGGCGACATCGTTGCCTGGTGGTAACAGCACGTGCACGTGCTTTTCTTTACCATCAGGTTAGACTACTTGTTGGTGTTCTCAAGGCTGTTGGCACTGGAAACTTAACAATTCCGGACGTTGAAAGAATTTTGAATGCGAGGACTGTTACGGCCGCAAGTCCAATGGCCCCGGCATGTGGTCTCTACCTAGGAGAGGTGAAATATGATCTGCCTACCACATAG

>Glyma16g00480.1   sequence type=predicted peptide   gene model=Glyma16g00480   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTENLKHTVDLECSDNNINRPSKISIIEYPIDSDIDEEEEMIKNPRNGIQRYLVAIEYIGTRFSGSQKQLNVRTVVGVLEEAFSKFVGQPVSVSCSSRTDAGVHALSNVCHVDIQRISKRRPGEVLTPHEPAVVGRAVNHFLQKQDSDLMVIDVRCVPSDFHARFKAQERIYFYRLLSGPEPLSTFEKDRAWHVPEELSLPAMQEACRVLVGFHDFSSFRAAGCQAKSPIRTLDELSVNEVIESPYFPSLMDREQHNKVSGDLRSCPNNSETDIPPTSNPSIDKVMASSQDVGFGKRRRHRCLVVTARARAFLYHQVRLLVGVLKAVGTGNLTIPDVERILNARTVTAASPMAPACGLYLGEVKYDLPTT*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo