|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G51400 | AT | Annotation by Michelle Graham. TAIR10: Photosystem II 5 kD protein | chr1:19052172-19052492 REVERSE LENGTH=106 | SoyBase | E_val: 4.00E-22 | ISS |
| GO:0009611 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to wounding | SoyBase | N/A | ISS |
| GO:0010193 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to ozone | SoyBase | N/A | ISS |
| GO:0010224 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to UV-B | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0009535 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane | SoyBase | N/A | ISS |
| GO:0009543 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid lumen | SoyBase | N/A | ISS |
| GO:0030095 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast photosystem II | SoyBase | N/A | ISS |
| GO:0003674 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: molecular function | SoyBase | N/A | ISS |
| UniRef100_G7IWU5 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Photosystem II 5 kDa protein n=1 Tax=Medicago truncatula RepID=G7IWU5_MEDTR | SoyBase | E_val: 8.00E-44 | ISS |
| UniRef100_I1MJQ4 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MJQ4_SOYBN | SoyBase | E_val: 9.00E-68 | ISS |
|
Glyma15g43100 not represented in the dataset |
Glyma15g43100 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.15g275600 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma15g43100.1 sequence type=CDS gene model=Glyma15g43100 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGCATCATTCACCATGACAGCTTCCATCCTTGGCAGCCCAGCCGTCACCAACCGGTCGGCAGTAGCAACGCAGAGGAGATCACTCGTAGTGAATGCTGCCAAAGCTGTTGAAGCAGAAAAGGTCAGTTATGACAATGACATGGATGGTAGCAATGGAAGGAGGAACTTGATGTTCGCCGCGGCGGCGGCTGCTGTTTGCTCTGTTGCTGGGATGGCAGTGGCAGATGAGCCTAAACCAGGAACCCCAGAAGCCAAGAAAAAGTATGCTCCGATTTGTGTCACCATGCCAACTGCTAGGATTTGTCGCAATTGA
>Glyma15g43100.1 sequence type=predicted peptide gene model=Glyma15g43100 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MASFTMTASILGSPAVTNRSAVATQRRSLVVNAAKAVEAEKVSYDNDMDGSNGRRNLMFAAAAAAVCSVAGMAVADEPKPGTPEAKKKYAPICVTMPTARICRN*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||