Glyma15g42900 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g42900

Feature Type:	gene_model
Chromosome:	Gm15
Start:	50331301
stop:	50335234
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma15g42900

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G13490	AT	Annotation by Michelle Graham. TAIR10: ADP/ATP carrier 2 \| chr5:4336034-4337379 FORWARD LENGTH=385	SoyBase	E_val: 0	ISS
GO:0006094	GO-bp	Annotation by Michelle Graham. GO Biological Process: gluconeogenesis	SoyBase	N/A	ISS
GO:0006612	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane	SoyBase	N/A	ISS
GO:0006810	GO-bp	Annotation by Michelle Graham. GO Biological Process: transport	SoyBase	N/A	ISS
GO:0006820	GO-bp	Annotation by Michelle Graham. GO Biological Process: anion transport	SoyBase	N/A	ISS
GO:0006862	GO-bp	Annotation by Michelle Graham. GO Biological Process: nucleotide transport	SoyBase	N/A	ISS
GO:0006865	GO-bp	Annotation by Michelle Graham. GO Biological Process: amino acid transport	SoyBase	N/A	ISS
GO:0006888	GO-bp	Annotation by Michelle Graham. GO Biological Process: ER to Golgi vesicle-mediated transport	SoyBase	N/A	ISS
GO:0007010	GO-bp	Annotation by Michelle Graham. GO Biological Process: cytoskeleton organization	SoyBase	N/A	ISS
GO:0010363	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response	SoyBase	N/A	ISS
GO:0010498	GO-bp	Annotation by Michelle Graham. GO Biological Process: proteasomal protein catabolic process	SoyBase	N/A	ISS
GO:0015696	GO-bp	Annotation by Michelle Graham. GO Biological Process: ammonium transport	SoyBase	N/A	ISS
GO:0015802	GO-bp	Annotation by Michelle Graham. GO Biological Process: basic amino acid transport	SoyBase	N/A	ISS
GO:0015865	GO-bp	Annotation by Michelle Graham. GO Biological Process: purine nucleotide transport	SoyBase	N/A	ISS
GO:0043069	GO-bp	Annotation by Michelle Graham. GO Biological Process: negative regulation of programmed cell death	SoyBase	N/A	ISS
GO:0043090	GO-bp	Annotation by Michelle Graham. GO Biological Process: amino acid import	SoyBase	N/A	ISS
GO:0043269	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of ion transport	SoyBase	N/A	ISS
GO:0055085	GO-bp	Annotation by Michelle Graham. GO Biological Process: transmembrane transport	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0005740	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial envelope	SoyBase	N/A	ISS
GO:0005743	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial inner membrane	SoyBase	N/A	ISS
GO:0005774	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009941	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0005215	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transporter activity	SoyBase	N/A	ISS
GO:0005471	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP:ADP antiporter activity	SoyBase	N/A	ISS
GO:0005507	GO-mf	Annotation by Michelle Graham. GO Molecular Function: copper ion binding	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
KOG0749	KOG	Mitochondrial ADP/ATP carrier proteins	JGI		ISS
PTHR24089	Panther	FAMILY NOT NAMED	JGI		ISS
PTHR24089:SF35	Panther	SUBFAMILY NOT NAMED	JGI		ISS
PF00153	PFAM	Mitochondrial carrier protein	JGI		ISS
UniRef100_I1MJN2	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MJN2_SOYBN	SoyBase	E_val: 0	ISS
UniRef100_O49875	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Adenine nucleotide translocator n=1 Tax=Lupinus albus RepID=O49875_LUPAL	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma15g42900

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma15g42900

Paralog	Evidence	Comments
Glyma08g16420	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma15g42900 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.15g273600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma15g42900

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma15g42900

Limit To All Plant Sequences

>Glyma15g42900.1   sequence type=CDS   gene model=Glyma15g42900   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTTGATCAGGTCCAACACCCTACAATCATGGACAAGGTTGCTGGTCAGCTCCATCTCCGTTCTGGTCTTTCATCTGGTATTAGAAGTTATGATGGAGCCTACCGCCACCCAGCTATGTACCAAAGACCCTCTTTTGGGAATTACTCGAATGCTGCATTGCAGTTTCCTGTGATGCCCACATGCAAAGCTACCATGGATTTGTCTGCTACTGCAACATCTGCCTCACCCGTCTTTGTTGCTGCTCCAGCAGAGAAAGGCCATTTTCTTTTAGACTTTCTCATGGGAGGTGTTTCAGCAGCTGTCTCCAAAACTGCTGCTGCTCCCATTGAACGTGTTAAGCTTTTGATCCAGAACCAGGATGAGATGATCAAAACTGGTAGGCTTTCTGAGCCCTACAAAGGTATTGGTGATTGTTTCAAGAGAACAATGGCAGATGAGGGTGCTATTTCTCTATGGAGAGGAAACACTGCTAATGTTATCCGTTATTTCCCCACCCAGGCTTTGAACTTTGCATTTAAGGATTACTTCAAGAGGCTTTTCAACTTTAAGAAGGATAGAGATGGCTACTGGAAATGGTTTGCTGGCAACTTGGCCTCTGGTGGTGCTGCTGGTGCATCATCCCTTTTGTTTGTTTACTCTCTTGACTATGCCCGTACCCGTCTTGCCAATGATGCAAAGGCTGCAAAAAAGGGTGGAGAGAGACAATTCAATGGTCTCGTTGATGTCTACAGGAAGACATTGGCATCTGATGGTGTTGCCGGGCTCTACCGTGGTTTCAACATCTCATGTGTTGGAATCATCGTGTATCGTGGTCTGTACTTTGGATTGTATGATTCTGTTAAACCAGTTGTCCTCACAGGGTCATTGCAGGATAGCTTTTTTGCCAGCTTTGCCCTTGGATGGCTCATCACCAATGGTGCAGGTCTTGCATCATACCCAATAGACACTGTTAGAAGAAGAATGATGATGACCTCTGGTGAAGCTGTCAAGTACAAGAGCTCCTTGGATGCATTCACACAGATCCTCAAGAATGAGGGTGCCAAGTCCTTGTTCAAGGGTGCCGGTGCCAACATCCTCCGTGCCGTTGCCGGTGCTGGTGTGCTTGCTGGTTATGACAAGTTGCAGGTTCTTGTGTTCGGCAAGAAGTACGGCTCTGGTGGGGCTTAA

Predicted protein sequences of Glyma15g42900

Limit To All Plant Sequences

>Glyma15g42900.1   sequence type=predicted peptide   gene model=Glyma15g42900   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVDQVQHPTIMDKVAGQLHLRSGLSSGIRSYDGAYRHPAMYQRPSFGNYSNAALQFPVMPTCKATMDLSATATSASPVFVAAPAEKGHFLLDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKTGRLSEPYKGIGDCFKRTMADEGAISLWRGNTANVIRYFPTQALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDAKAAKKGGERQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGLYDSVKPVVLTGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFTQILKNEGAKSLFKGAGANILRAVAGAGVLAGYDKLQVLVFGKKYGSGGA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain