SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g42610

Feature Type:gene_model
Chromosome:Gm15
Start:50049510
stop:50054251
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g42610
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G52150AT Annotation by Michelle Graham. TAIR10: RNA-binding (RRM/RBD/RNP motifs) family protein | chr3:19342074-19343090 FORWARD LENGTH=253 SoyBaseE_val: 3.00E-97ISS
GO:0009773GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthetic electron transport in photosystem I SoyBaseN/AISS
GO:0019288GO-bp Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway SoyBaseN/AISS
GO:0045036GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to chloroplast SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009535GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0009579GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0003676GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding SoyBaseN/AISS
GO:0003723GO-mf Annotation by Michelle Graham. GO Molecular Function: RNA binding SoyBaseN/AISS
KOG0131 KOG Splicing factor 3b, subunit 4 JGI ISS
PTHR24012Panther FAMILY NOT NAMED JGI ISS
PTHR24012:SF56Panther SUBFAMILY NOT NAMED JGI ISS
PF00076PFAM RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) JGI ISS
UniRef100_G7J1T1UniRef Annotation by Michelle Graham. Most informative UniRef hit: 30S ribosomal protein n=1 Tax=Medicago truncatula RepID=G7J1T1_MEDTR SoyBaseE_val: 8.00E-109ISS
UniRef100_UPI00018C6EECUniRef Annotation by Michelle Graham. Best UniRef hit: UPI00018C6EEC related cluster n=1 Tax=unknown RepID=UPI00018C6EEC SoyBaseE_val: 8.00E-177ISS

Expression Patterns of Glyma15g42610
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma15g42610
ParalogEvidenceComments
Glyma08g16100 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma15g42610 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g271200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma15g42610
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g42610
>Glyma15g42610.1   sequence type=CDS   gene model=Glyma15g42610   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTCTGTTCACTCTTCTTTCCTTCTACCATATAATCTCCTTTCCCTCACAACCCCATCAAGCTCTTCCACTCAAATTCTCTTTACCGCGAGACCCTCCGCGACCCACCTGCGACCCCTTCTTCTCACCACACGACGCCGTTCCGGGAGACGACCCTTTGCCGCGGTGGCGGAACAGGCCGCCACCGCGACCGAGGCGGCCGCGAGGAGGCTCTACGTTGGCAACATTCCCCGCACTGTCACCAATGACGAGCTTGCCAAGATTGTTCAGGAGCATGGCGCTGTTGAGAAAGCTGAGGTAATGTATGACAAATACTCTGGAAGGAGCCGTCGCTTTGCATTCGTTACCATGAAAACTGTTGAGGACGCAACTGCTGTGATTGAGAAACTTAACGGCACTGAACTTGGAGGGCGTGAGATCAAAGTAAATGTAACTGAAAAACCTTTATCAACACTAGATTTGCCTTTACTCCAAGCCGAGGAATCTGAATTTATTGACAGTCCCCACAAGGTGTATGTGGGAAATCTGGCCAAGACAGTAACAACTGATACTCTTAAAAACTTTTTTTCTGAGAAGGGAAAAGTTCTTAGTGCCAAGGTTTCACGGGTCCCTGGTACCTCAAAATCCAGTGGATATGGTTTTGTTACTTTTCCGTCAGAAGAGGATGTAGAAGCTGCAATCTCATCATTCAACAATTCTTTGTTAGAAGGCCAAACAATCCGTGTGAACAAGGCATAG
Predicted protein sequences of Glyma15g42610
>Glyma15g42610.1   sequence type=predicted peptide   gene model=Glyma15g42610   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASVHSSFLLPYNLLSLTTPSSSSTQILFTARPSATHLRPLLLTTRRRSGRRPFAAVAEQAATATEAAARRLYVGNIPRTVTNDELAKIVQEHGAVEKAEVMYDKYSGRSRRFAFVTMKTVEDATAVIEKLNGTELGGREIKVNVTEKPLSTLDLPLLQAEESEFIDSPHKVYVGNLAKTVTTDTLKNFFSEKGKVLSAKVSRVPGTSKSSGYGFVTFPSEEDVEAAISSFNNSLLEGQTIRVNKA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo