Glyma15g42561 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma15g42561): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma15g42561): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma15g42561

Feature Type:	gene_model
Chromosome:	Gm15
Start:	49991908
stop:	49992538
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma15g42561

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G02280	AT	Annotation by Michelle Graham. TAIR10: sucrose synthase 3 \| chr4:995166-998719 FORWARD LENGTH=809	SoyBase	E_val: 2.00E-89	ISS
GO:0001666	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to hypoxia	SoyBase	N/A	ISS
GO:0005982	GO-bp	Annotation by Michelle Graham. GO Biological Process: starch metabolic process	SoyBase	N/A	ISS
GO:0005985	GO-bp	Annotation by Michelle Graham. GO Biological Process: sucrose metabolic process	SoyBase	N/A	ISS
GO:0005986	GO-bp	Annotation by Michelle Graham. GO Biological Process: sucrose biosynthetic process	SoyBase	N/A	ISS
GO:0009414	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to water deprivation	SoyBase	N/A	ISS
GO:0010431	GO-bp	Annotation by Michelle Graham. GO Biological Process: seed maturation	SoyBase	N/A	ISS
GO:0010555	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to mannitol stimulus	SoyBase	N/A	ISS
GO:0019375	GO-bp	Annotation by Michelle Graham. GO Biological Process: galactolipid biosynthetic process	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0008194	GO-mf	Annotation by Michelle Graham. GO Molecular Function: UDP-glycosyltransferase activity	SoyBase	N/A	ISS
GO:0016157	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sucrose synthase activity	SoyBase	N/A	ISS
GO:0016757	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring glycosyl groups	SoyBase	N/A	ISS
PTHR12526	Panther	GLYCOSYLTRANSFERASE	JGI		ISS
PTHR12526:SF27	Panther	SUCROSE SYNTHASE	JGI		ISS
PF00862	PFAM	Sucrose synthase	JGI		ISS
UniRef100_O24301	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Sucrose synthase 2 n=1 Tax=Pisum sativum RepID=SUS2_PEA	SoyBase	E_val: 1.00E-92	ISS
UniRef100_UPI000233E1AD	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233E1AD related cluster n=1 Tax=unknown RepID=UPI000233E1AD	SoyBase	E_val: 2.00E-100	ISS

Expression Patterns of Glyma15g42561

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g42561 not represented in the dataset	Glyma15g42561 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g42561 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma15g42561

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma15g42561

Limit To All Plant Sequences

>Glyma15g42561.1   sequence type=CDS   gene model=Glyma15g42561   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCGAGGATTATCTTTCTAAGCTTGCTAGTGGTACACTCTATTCAGAGTTTGAATATGTATTACAAGGAATGGATTTTGAGAGAGGTTGGGGCGATACTGCTGAACGGGTATTGGAATTATCTGATATGCTCCTAGATATTCTTCAGGCTCCTGATCATTATACACTAGAGACTTTTCTTGAGAGAGAGCCAATGGTATTCAATGTTGATATATTATCTCCTCATGGCTACTTTGGACAAGCCAATGTCTTGGGTTTGCCTGACACTGGTGGGCAAGTTGTTTATATACTAGGTCAAGTGCGTGCCCTTGAAAATGAGATGCTCCTTCAGATCAAGAAACAAGGACTTGATTTCACTCCTAGAATTCTAATTGTTACCAGGTTAATAGCTGATGCAAAGGGGACAACATGTAACCAGCGGTTAGAAAGAGTCAATGGTACTGACCATACTCATATTTTGCAAGTTCCATTCAGATCAGAGTTAGGAACTCTCAGTAAATGGATCTCAAGGTTTGATGTGTGGACTTAG

Predicted protein sequences of Glyma15g42561

Limit To All Plant Sequences

>Glyma15g42561.1   sequence type=predicted peptide   gene model=Glyma15g42561   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAEDYLSKLASGTLYSEFEYVLQGMDFERGWGDTAERVLELSDMLLDILQAPDHYTLETFLEREPMVFNVDILSPHGYFGQANVLGLPDTGGQVVYILGQVRALENEMLLQIKKQGLDFTPRILIVTRLIADAKGTTCNQRLERVNGTDHTHILQVPFRSELGTLSKWISRFDVWT*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain