Report for Sequence Feature Glyma15g42490
Feature Type: gene_model
Chromosome: Gm15
Start: 49919882
stop: 49920574
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma15g42490
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
UniRef100_I1MJK5 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MJK5_SOYBN
SoyBase E_val: 1.00E-36 ISS
Expression Patterns of Glyma15g42490
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Gene model name correspondences to Glyma15g42490 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.15g270000 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma15g42490
Coding sequences of Glyma15g42490
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma15g42490.1 sequence type=CDS gene model=Glyma15g42490 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGATATATATGGCTTTGATGTCATATTTCTTGAATTGCTTTACTCCATCCACATCATGTCAAGTCTCTGACTATGCCGAAGGATCATCTCAACTGAAATCTCCTTCTTCAGAGAAACAAAAATCAAGAGGAGCTCCACTTGTTGTTTCCTATTTCCCCATCAACCATTATCCCTCGCGCTTATAG
Predicted protein sequences of Glyma15g42490
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma15g42490.1 sequence type=predicted peptide gene model=Glyma15g42490 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MIYMALMSYFLNCFTPSTSCQVSDYAEGSSQLKSPSSEKQKSRGAPLVVSYFPINHYPSRL*