Glyma15g42260 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g42260

Feature Type:	gene_model
Chromosome:	Gm15
Start:	49653652
stop:	49654050
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma15g42260

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G31945	AT	Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: endomembrane system; EXPRESSED IN: 8 plant structures; EXPRESSED DURING: 4 anthesis, petal differentiation and expansion stage; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G05575.1); Has 61 Blast hits to 61 proteins in 10 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 61; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). \| chr2:135816	SoyBase	E_val: 3.00E-17	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0009407	GO-bp	Annotation by Michelle Graham. GO Biological Process: toxin catabolic process	SoyBase	N/A	ISS
GO:0009693	GO-bp	Annotation by Michelle Graham. GO Biological Process: ethylene biosynthetic process	SoyBase	N/A	ISS
GO:0010583	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cyclopentenone	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
UniRef100_I1MJI6	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1MJI6_SOYBN	SoyBase	E_val: 5.00E-42	ISS

Expression Patterns of Glyma15g42260

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma15g42260

Paralog	Evidence	Comments
Glyma08g16810	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma15g42260 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.15g268200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma15g42260

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma15g42260

Limit To All Plant Sequences

>Glyma15g42260.2   sequence type=CDS   gene model=Glyma15g42260   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGAGCAGCTTGGGAGACATGTTGATTAAGGTTGTGGTGTTCATTCTAGTTCAAGCCTTGGTGTACCTTATCCTCTCCAATTCATCAAACATCTTCAACAAGAACATGAAGAAATCCAACAGCTTCAGGCCAGCGAGGTCGGTGAGCATTCGCCGGATGCTGGCTTTGATCTCTGATTTTCCTCCAGAAGGGGAACCCTCTCCTTCACCAAAGGACTAG

Predicted protein sequences of Glyma15g42260

Limit To All Plant Sequences

>Glyma15g42260.2   sequence type=predicted peptide   gene model=Glyma15g42260   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MESSLGDMLIKVVVFILVQALVYLILSNSSNIFNKNMKKSNSFRPARSVSIRRMLALISDFPPEGEPSPSPKD*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain