SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g42250

Feature Type:gene_model
Chromosome:Gm15
Start:49646761
stop:49649623
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g42250
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G60080AT Annotation by Michelle Graham. TAIR10: RING/U-box superfamily protein | chr3:22187635-22188555 FORWARD LENGTH=306 SoyBaseE_val: 4.00E-28ISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
PTHR22763Panther RING ZINC FINGER PROTEIN JGI ISS
PF00097PFAM Zinc finger, C3HC4 type (RING finger) JGI ISS
UniRef100_I1MJI5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MJI5_SOYBN SoyBaseE_val: 2.00E-169ISS
UniRef100_Q002B3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Cytokinesis negative regulator RCP1 n=1 Tax=Nicotiana tabacum RepID=Q002B3_TOBAC SoyBaseE_val: 2.00E-31ISS

Expression Patterns of Glyma15g42250
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma15g42250
ParalogEvidenceComments
Glyma08g16830 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma15g42250 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g268100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma15g42250
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g42250
>Glyma15g42250.1   sequence type=CDS   gene model=Glyma15g42250   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGGCGACGGCGACGGCGGAAGCGAAAACCTACTGGTGCCACGAGTGCGACATGAGCGTGTCCCTGACTCTCCCACCCTCCCCTCTCCTCTGCCCTCACTGCCACACCCACTTCCTTGAACTCATGGACTCCCCAAGCCTCTCCCAAGAAAACGACGCCGAATCATCCCTCTTCGATGTCGTTTTTCAAGACGCACTCTTACTCCTCAACCCTAACCCTAACCCTAACCCTAAGCCACTTCCCTCCAAACCCCTTCCCCTCCCCTCCCTCCACGTCACCCCCTCCCTCCTCTCCTCCCTCGACCCCAACGGCGTCGTTCTCTGCGCCGTCTGCAAAGACCAAATTACCCTCAACGCCCAAGCCAAACAATTGCCCTGCCAACACCTCTACCACTCCGATTGCATCACGCCGTGGATAGAACTCAACTCGTCGTGTCCGCTATGCAGGTTTCGGTTGGAGGAAGAAGAGGAGGAAGGTGGTGACGCCGACGCTGACGCCGACGCCGTTATGACGGAGATCAGGAGGGAGATCATTGCGAGGCTGACGGAGCTGACGGAGGAGGATTTCTACGGGCTCAGGACCACGCTCAGCCACATTGCCTCGCGCCACGCGCTCATCGAAGAGAACCAGAATCATCGCGCGCAGATTGGCGAGCCTCGCGGCGGCGGCGGTGGAGGTGGCGGCGATTCGGCTTGCTGA
Predicted protein sequences of Glyma15g42250
>Glyma15g42250.1   sequence type=predicted peptide   gene model=Glyma15g42250   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAATATAEAKTYWCHECDMSVSLTLPPSPLLCPHCHTHFLELMDSPSLSQENDAESSLFDVVFQDALLLLNPNPNPNPKPLPSKPLPLPSLHVTPSLLSSLDPNGVVLCAVCKDQITLNAQAKQLPCQHLYHSDCITPWIELNSSCPLCRFRLEEEEEEGGDADADADAVMTEIRREIIARLTELTEEDFYGLRTTLSHIASRHALIEENQNHRAQIGEPRGGGGGGGGDSAC*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo