Glyma15g42050 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g42050

Feature Type:	gene_model
Chromosome:	Gm15
Start:	49428553
stop:	49432624
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma15g42050

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G79580	AT	Annotation by Michelle Graham. TAIR10: NAC (No Apical Meristem) domain transcriptional regulator superfamily protein \| chr1:29941020-29942925 REVERSE LENGTH=371	SoyBase	E_val: 2.00E-116	ISS
GO:0003002	GO-bp	Annotation by Michelle Graham. GO Biological Process: regionalization	SoyBase	N/A	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0007275	GO-bp	Annotation by Michelle Graham. GO Biological Process: multicellular organismal development	SoyBase	N/A	ISS
GO:0009834	GO-bp	Annotation by Michelle Graham. GO Biological Process: secondary cell wall biogenesis	SoyBase	N/A	ISS
GO:0010455	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of cell fate commitment	SoyBase	N/A	ISS
GO:0048829	GO-bp	Annotation by Michelle Graham. GO Biological Process: root cap development	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
PF02365	PFAM	No apical meristem (NAM) protein	JGI		ISS
UniRef100_A2Q3I9	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: NAC domain-containing protein n=1 Tax=Medicago truncatula RepID=A2Q3I9_MEDTR	SoyBase	E_val: 9.00E-176	ISS
UniRef100_I1MJG9	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MJG9_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma15g42050

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma15g42050

Paralog	Evidence	Comments
Glyma08g17140	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma15g42050 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.15g266500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma15g42050

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma15g42050

Limit To All Plant Sequences

>Glyma15g42050.1   sequence type=CDS   gene model=Glyma15g42050   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATGCCAGGCAATGGACAGTTAACTGTTCCTCCGGGCTTCAGGTTCCACCCTACTGATGAGGAGCTTCTCTACTATTATCTGAGGAAGAAAGTTTCTTATGAAGTCATTGATCTTGATGTCATAAGAGAAGTAGATCTCAACAAACTTGAGCCTTGGGACCTCAAAGATAAGTGTAGGATTGGATCAGGGCCTCAGAATGAGTGGTATTTCTTCAGCCATAAGGACAAGAAATACCCAACAGGAACCAGAACAAATCGAGCAACTACAGCTGGTTTTTGGAAAGCAACTGGAAGAGACAAGTCCATATACCACACTAATTCCAAGAGGATTGGCATGAGGAAAACCCTAGTTTTCTACACTGGTCGTGCTCCTCATGGCCAGAAGACTGATTGGATCATGCATGAGTATCGCCTTGATGAAGATGATGCTGATGTTCAAGAAGATGGGTGGGTGGTATGCAGGGTCTTCAAAAAGAAAAACCAAAGCCGAGGTTTCCAACAAGAACTTGAAGAAGAAGAGCACTTAACCACCCACATGAGAGCAAGTGGTCCATGCCAGGTTCTAGAGCAGAAGCATCTTCACATGCAAGGAGGACCATATGATCATTACAACTTTGATGGGACAATGCACCTCCCACAGTTGTTCAGTCCAGAATCAGCTATTGCACCACCTACAAATTCTTCCTTGGCCTTATCCATGAATGCCATGGACATCCTTGAGTGCTCTCAAAACCTGTTGAGGCTCACAACCACTGGCTGTGGACTTAATCTTATGCAGCAACAACAAGAAGAGAGGTTCAGTGGTGACTGGTCTTTCTTGGACAAGCTACTAGCATCACACCATGGCATGGATCAAAGCAAATGTAACCCTCCTACTAATCATCATGCTGCAACTGCTGTGGGCACTTCTGCTCAAAAATTCCCATTTCATTACCTTGGCTGTGACACCACCCATGATATCATGAAATTTTCCAAGTAG

Predicted protein sequences of Glyma15g42050

Limit To All Plant Sequences

>Glyma15g42050.1   sequence type=predicted peptide   gene model=Glyma15g42050   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MMPGNGQLTVPPGFRFHPTDEELLYYYLRKKVSYEVIDLDVIREVDLNKLEPWDLKDKCRIGSGPQNEWYFFSHKDKKYPTGTRTNRATTAGFWKATGRDKSIYHTNSKRIGMRKTLVFYTGRAPHGQKTDWIMHEYRLDEDDADVQEDGWVVCRVFKKKNQSRGFQQELEEEEHLTTHMRASGPCQVLEQKHLHMQGGPYDHYNFDGTMHLPQLFSPESAIAPPTNSSLALSMNAMDILECSQNLLRLTTTGCGLNLMQQQQEERFSGDWSFLDKLLASHHGMDQSKCNPPTNHHAATAVGTSAQKFPFHYLGCDTTHDIMKFSK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain