SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma15g42010

Feature Type:gene_model
Chromosome:Gm15
Start:49320826
stop:49324801
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G13510AT Annotation by Michelle Graham. TAIR10: Protein of Unknown Function (DUF239) | chr3:4403776-4405741 FORWARD LENGTH=419 SoyBaseE_val: 0ISS
GO:0006346GO-bp Annotation by Michelle Graham. GO Biological Process: methylation-dependent chromatin silencing SoyBaseN/AISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0009744GO-bp Annotation by Michelle Graham. GO Biological Process: response to sucrose stimulus SoyBaseN/AISS
GO:0009813GO-bp Annotation by Michelle Graham. GO Biological Process: flavonoid biosynthetic process SoyBaseN/AISS
GO:0009855GO-bp Annotation by Michelle Graham. GO Biological Process: determination of bilateral symmetry SoyBaseN/AISS
GO:0009887GO-bp Annotation by Michelle Graham. GO Biological Process: organ morphogenesis SoyBaseN/AISS
GO:0009944GO-bp Annotation by Michelle Graham. GO Biological Process: polarity specification of adaxial/abaxial axis SoyBaseN/AISS
GO:0010014GO-bp Annotation by Michelle Graham. GO Biological Process: meristem initiation SoyBaseN/AISS
GO:0010051GO-bp Annotation by Michelle Graham. GO Biological Process: xylem and phloem pattern formation SoyBaseN/AISS
GO:0010073GO-bp Annotation by Michelle Graham. GO Biological Process: meristem maintenance SoyBaseN/AISS
GO:0010075GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of meristem growth SoyBaseN/AISS
GO:0010224GO-bp Annotation by Michelle Graham. GO Biological Process: response to UV-B SoyBaseN/AISS
GO:0016246GO-bp Annotation by Michelle Graham. GO Biological Process: RNA interference SoyBaseN/AISS
GO:0048439GO-bp Annotation by Michelle Graham. GO Biological Process: flower morphogenesis SoyBaseN/AISS
GO:0048519GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of biological process SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
PF03080PFAM Arabidopsis proteins of unknown function JGI ISS
UniRef100_C6T970UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T970_SOYBN SoyBaseE_val: 0ISS
UniRef100_Q9LJE0UniRef Annotation by Michelle Graham. Most informative UniRef hit: AT3g13510/MRP15_15 n=1 Tax=Arabidopsis thaliana RepID=Q9LJE0_ARATH SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma08g17180 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g266100 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma15g42010.1   sequence type=CDS   gene model=Glyma15g42010   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGGAAGGTTGTGTTGTTGTTTCTTTGCATGGTGTTGGTGGTGGTGTCTTTGGCTTGTGCTGATTCAATTGAGAAGCTTGAGGTTCAGAAGCACTTGAAGAACTTGAATAGACCTCCTGTTAGGTCCATCAAGAGTCCTGATGGAGATGTTATTGACTGTATCCATGTCTCTCACCAGCCAGCTTTTGATCACCCTGACCTCAAAAATCACAAGATTCAGATGAAACCAAATTTCCATCCAGAAGGTCACCCTTTTGGAGAAAGCAAAGTCTCTTCAAATTCCAAGCCAATTACTCAGCCGTGGCACCAAAATGGGAGGTGCCCTGATGGAACAATTCCGGTCCGAAGGACGAAAAAGGATGACATGTTAAGGGCAAGCTCTGTTCAGCATTTTGGAAAGAAGAAGGATAGGAGCTTCCCTCAGCCAAAACCTGCAAAACCTCTACCTGACATCATCAGTCAGAGTGGCCACCAGCATGCCATAGCGTATGTGGAGGGAGATAAGTATTATGGAGCCAAGGCAACCATAAACGTCTGGGACCCAAAAATTCAACAGCCCAATGAATTTAGCCTTTCTCAAATGTGGATTTTGGGTGGCTCTTTTGGTCAAGATCTCAACAGCATTGAAGCAGGTTGGCAGGTCAGCCCTGATTTGTATGGAGACAACAATACTAGACTCTTCACTTATTGGACAAGTGATGCATATCAAGCTACTGGTTGTTATAATCTCCTTTGCTCTGGCTTTATTCAAATTAACAGTGATATAGCCCTGGGAGCAAGCATCTCCCCACTTTCTAAGTATAGCTCTTCCCAATATGATATCAGCATCCTGGTCTGGAAGGACCCCAAAGAGGGTAACTGGTGGATGCAGTTTGGGAATGACCATGTTATGGGATACTGGCCGGCTCCTCTATTCTCGTACCTCTCTGACAGCGCGTCAATGATTGAGTGGGGGGGAGAGGTTGTGAACTCTGAGTCCGACGGCCAACACACCTCGACTCAAATGGGGAGTGGCCATTTCCCTGAGGAGGGTTTTGGCAAGGCTAGTTACTTCAAGAACATTCAGATTGTTGATGGTGACAACAAGCTTAGAGCTCCAAAAGACCTTGGCACTTACACTGAGCAAGATAGCTGCTACAATGTCCAAACTGGTAGTGCTGGAGATTGGGGTAGCTACTTCTACTATGGTGGTCCTGGTAGAAACCCAAATTGCCCTTGA

>Glyma15g42010.1   sequence type=predicted peptide   gene model=Glyma15g42010   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGKVVLLFLCMVLVVVSLACADSIEKLEVQKHLKNLNRPPVRSIKSPDGDVIDCIHVSHQPAFDHPDLKNHKIQMKPNFHPEGHPFGESKVSSNSKPITQPWHQNGRCPDGTIPVRRTKKDDMLRASSVQHFGKKKDRSFPQPKPAKPLPDIISQSGHQHAIAYVEGDKYYGAKATINVWDPKIQQPNEFSLSQMWILGGSFGQDLNSIEAGWQVSPDLYGDNNTRLFTYWTSDAYQATGCYNLLCSGFIQINSDIALGASISPLSKYSSSQYDISILVWKDPKEGNWWMQFGNDHVMGYWPAPLFSYLSDSASMIEWGGEVVNSESDGQHTSTQMGSGHFPEEGFGKASYFKNIQIVDGDNKLRAPKDLGTYTEQDSCYNVQTGSAGDWGSYFYYGGPGRNPNCP*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo