|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT1G30870 | AT | Annotation by Michelle Graham. TAIR10: Peroxidase superfamily protein | chr1:10991535-10992885 FORWARD LENGTH=349 | SoyBase | E_val: 7.00E-13 | ISS |
GO:0006979 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to oxidative stress | SoyBase | N/A | ISS |
GO:0010054 | GO-bp | Annotation by Michelle Graham. GO Biological Process: trichoblast differentiation | SoyBase | N/A | ISS |
GO:0055114 | GO-bp | Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process | SoyBase | N/A | ISS |
GO:0005576 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: extracellular region | SoyBase | N/A | ISS |
GO:0004601 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: peroxidase activity | SoyBase | N/A | ISS |
GO:0020037 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: heme binding | SoyBase | N/A | ISS |
PF00141 | PFAM | Peroxidase | JGI | ISS | |
UniRef100_G7JMV9 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Peroxidase n=1 Tax=Medicago truncatula RepID=G7JMV9_MEDTR | SoyBase | E_val: 1.00E-28 | ISS |
UniRef100_UPI000233C129 | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI000233C129 related cluster n=1 Tax=unknown RepID=UPI000233C129 | SoyBase | E_val: 5.00E-59 | ISS |
Glyma15g41860 not represented in the dataset |
Glyma15g41860 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma.15g264400 | Wm82.a2.v1 | IGC | As supplied by JGI |
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma15g41860.1 sequence type=CDS gene model=Glyma15g41860 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGAGGCTCCACTACCTTACCCTTTTCCTTCTTTTGGTCCCTTTGGAGCTAAGCATCATTTATGGTCTTTCTACACTAGGAAATGTGCCTAAGAAATCATTCAAGCCCTTATTGCCCCCTGAGGCCTTGCTGTCCATTGGTCACTATCACACAACATGTCCTGATACTGAAGGCATCATCTCACAAAAGGTTGCAGCTTGGGTTAAGAAGGACCCTACATTGGCCCCTGCCATCATACGCCTTCATTTCCATGACTGTGCTGTTAGGGATCACATGGATTTGGTGCAAAAGGGTGCAAAAGGTGCAAAAGGGTGA
>Glyma15g41860.1 sequence type=predicted peptide gene model=Glyma15g41860 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MRLHYLTLFLLLVPLELSIIYGLSTLGNVPKKSFKPLLPPEALLSIGHYHTTCPDTEGIISQKVAAWVKKDPTLAPAIIRLHFHDCAVRDHMDLVQKGAKGAKG*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||