Glyma15g41780 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma15g41780): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma15g41780): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma15g41780

Feature Type:	gene_model
Chromosome:	Gm15
Start:	48978330
stop:	48978685
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma15g41780

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G48890	AT	Annotation by Michelle Graham. TAIR10: membrane-associated progesterone binding protein 3 \| chr3:18129669-18131353 FORWARD LENGTH=233	SoyBase	E_val: 8.00E-40	ISS
GO:0009684	GO-bp	Annotation by Michelle Graham. GO Biological Process: indoleacetic acid biosynthetic process	SoyBase	N/A	ISS
GO:0009723	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus	SoyBase	N/A	ISS
GO:0042742	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response to bacterium	SoyBase	N/A	ISS
GO:0048523	GO-bp	Annotation by Michelle Graham. GO Biological Process: negative regulation of cellular process	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005783	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0009535	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane	SoyBase	N/A	ISS
GO:0020037	GO-mf	Annotation by Michelle Graham. GO Molecular Function: heme binding	SoyBase	N/A	ISS
PTHR10281	Panther	MEMBRANE ASSOCIATED PROGESTERONE RECEPTOR-RELATED	JGI		ISS
PTHR10281:SF26	Panther	MEMBRANE STEROID BINDING PROTEIN	JGI		ISS
UniRef100_B9R9D3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Steroid binding protein, putative n=1 Tax=Ricinus communis RepID=B9R9D3_RICCO	SoyBase	E_val: 1.00E-44	ISS
UniRef100_I1MJE5	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1MJE5_SOYBN	SoyBase	E_val: 2.00E-70	ISS

Expression Patterns of Glyma15g41780

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g41780 not represented in the dataset	Glyma15g41780 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g41780 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma15g41780

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma15g41780

Limit To All Plant Sequences

>Glyma15g41780.1   sequence type=CDS   gene model=Glyma15g41780   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTTGTGCAGCTGTGGGAAACCCTGAAGGAAGCCATTGTAGCCTACACTGGCTTCTCTCCTTCCACCTTCTTCACGGTGCTGGCGCTTCTTTTTGCCATTTACTACGTTGTCACAGGTCTCTTTGGCTCCTCCGACGACCACCATCACCGCCACCGCCACATCGAGGAGGAGGAAGAGGAGGAGATGTCGCCTCTACACCCCCCGGTTCAGCTCGACGAGATCACAGCGGAGGAGCTCAAGGCCTACGATAGCATCGATCTTGAGAAGCCCTTGCTCATGGCCATCAAGGCCCAGATCTATGATGTCTCCCAGAGCAGG

Predicted protein sequences of Glyma15g41780

Limit To All Plant Sequences

>Glyma15g41780.1   sequence type=predicted peptide   gene model=Glyma15g41780   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVVQLWETLKEAIVAYTGFSPSTFFTVLALLFAIYYVVTGLFGSSDDHHHRHRHIEEEEEEEMSPLHPPVQLDEITAEELKAYDSIDLEKPLLMAIKAQIYDVSQSR

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain