Glyma15g41493 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g41493

Feature Type:	gene_model
Chromosome:	Gm15
Start:	48595829
stop:	48596685
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma15g41493

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G03170	AT	Annotation by Michelle Graham. TAIR10: SKP1-like 14 \| chr2:961322-961771 FORWARD LENGTH=149	SoyBase	E_val: 3.00E-32	ISS
GO:0006511	GO-bp	Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0004842	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ubiquitin-protein ligase activity	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
KOG1724	KOG	SCF ubiquitin ligase, Skp1 component	JGI		ISS
PTHR11165	Panther	SKP1	JGI		ISS
PF01466	PFAM	Skp1 family, dimerisation domain	JGI		ISS
PF03931	PFAM	Skp1 family, tetramerisation domain	JGI		ISS
UniRef100_G0WRD2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: SKP1 n=1 Tax=Hevea brasiliensis RepID=G0WRD2_HEVBR	SoyBase	E_val: 7.00E-40	ISS
UniRef100_I1MJC3	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1MJC3_SOYBN	SoyBase	E_val: 5.00E-67	ISS

Expression Patterns of Glyma15g41493

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g41493 not represented in the dataset	Glyma15g41493 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g41493 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.15g261500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma15g41493

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma15g41493

Limit To All Plant Sequences

>Glyma15g41493.1   sequence type=CDS   gene model=Glyma15g41493   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGAGAAAAAGGAGAATCATCCAAATCGGCTATGCTGAAGCATGCAGAGGAAGAAGAATTGAATACAAAAAGATTGAAAACTGTGGAGGGGGAAGAATCCAATATGGTAGAAGAAACAGAAAACATTAAGCTGAAAACTTCAGATGAAATCATCTTCGAGGTGGAACCCTCGATCGTGAAGGAGATGGTGACGATACAGACCTTCATCGAGGACAACAACAACGAAACTTCCATCCCCATTCCGCTCCCCAACGTCACCAGTAATACTCTCCGTCGAATCCTCGAGTTCAAAGCTCGAGGATTCGACGAAGAGTTCGTGAAGACGTTGGGCATGGACGAGGTTTTCGAACTGATCCTCGCTGCCAACTACCTCAACATGAAAACCCTCCTGGATATCCTGACTAAGATCATTGCAGACTTCATCAAGAATAAGAGCGTGGAGTTTGTTAGGAAGTTCTTCAACATCGTCAACGATTTCACACCCGAGGAAGAGGCCAAGATTCGTGAAGAAAATGCCTGGGCCTTTGAGGGATTTGAGTGCGATGATTGA

Predicted protein sequences of Glyma15g41493

Limit To All Plant Sequences

>Glyma15g41493.1   sequence type=predicted peptide   gene model=Glyma15g41493   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGEKGESSKSAMLKHAEEEELNTKRLKTVEGEESNMVEETENIKLKTSDEIIFEVEPSIVKEMVTIQTFIEDNNNETSIPIPLPNVTSNTLRRILEFKARGFDEEFVKTLGMDEVFELILAANYLNMKTLLDILTKIIADFIKNKSVEFVRKFFNIVNDFTPEEEAKIREENAWAFEGFECDD*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain