SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Notice: fwrite(): Write of 157 bytes failed with errno=28 No space left on device in /var/www/html/include/SeqFeatClass.php on line 369

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma15g41493): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma15g41493): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma15g41493

Feature Type:gene_model
Chromosome:Gm15
Start:48595829
stop:48596685
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G03170AT Annotation by Michelle Graham. TAIR10: SKP1-like 14 | chr2:961322-961771 FORWARD LENGTH=149 SoyBaseE_val: 3.00E-32ISS
GO:0006511GO-bp Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0004842GO-mf Annotation by Michelle Graham. GO Molecular Function: ubiquitin-protein ligase activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
KOG1724 KOG SCF ubiquitin ligase, Skp1 component JGI ISS
PTHR11165Panther SKP1 JGI ISS
PF01466PFAM Skp1 family, dimerisation domain JGI ISS
PF03931PFAM Skp1 family, tetramerisation domain JGI ISS
UniRef100_G0WRD2UniRef Annotation by Michelle Graham. Most informative UniRef hit: SKP1 n=1 Tax=Hevea brasiliensis RepID=G0WRD2_HEVBR SoyBaseE_val: 7.00E-40ISS
UniRef100_I1MJC3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1MJC3_SOYBN SoyBaseE_val: 5.00E-67ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g41493 not represented in the dataset

Glyma15g41493 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g261500 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma15g41493.1   sequence type=CDS   gene model=Glyma15g41493   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGAGAAAAAGGAGAATCATCCAAATCGGCTATGCTGAAGCATGCAGAGGAAGAAGAATTGAATACAAAAAGATTGAAAACTGTGGAGGGGGAAGAATCCAATATGGTAGAAGAAACAGAAAACATTAAGCTGAAAACTTCAGATGAAATCATCTTCGAGGTGGAACCCTCGATCGTGAAGGAGATGGTGACGATACAGACCTTCATCGAGGACAACAACAACGAAACTTCCATCCCCATTCCGCTCCCCAACGTCACCAGTAATACTCTCCGTCGAATCCTCGAGTTCAAAGCTCGAGGATTCGACGAAGAGTTCGTGAAGACGTTGGGCATGGACGAGGTTTTCGAACTGATCCTCGCTGCCAACTACCTCAACATGAAAACCCTCCTGGATATCCTGACTAAGATCATTGCAGACTTCATCAAGAATAAGAGCGTGGAGTTTGTTAGGAAGTTCTTCAACATCGTCAACGATTTCACACCCGAGGAAGAGGCCAAGATTCGTGAAGAAAATGCCTGGGCCTTTGAGGGATTTGAGTGCGATGATTGA

>Glyma15g41493.1   sequence type=predicted peptide   gene model=Glyma15g41493   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGEKGESSKSAMLKHAEEEELNTKRLKTVEGEESNMVEETENIKLKTSDEIIFEVEPSIVKEMVTIQTFIEDNNNETSIPIPLPNVTSNTLRRILEFKARGFDEEFVKTLGMDEVFELILAANYLNMKTLLDILTKIIADFIKNKSVEFVRKFFNIVNDFTPEEEAKIREENAWAFEGFECDD*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo