Glyma15g41330 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma15g41330): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma15g41330): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma15g41330

Feature Type:	gene_model
Chromosome:	Gm15
Start:	48432383
stop:	48443348
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma15g41330

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G16470	AT	Annotation by Michelle Graham. TAIR10: proteasome subunit PAB1 \| chr1:5623122-5625439 FORWARD LENGTH=235	SoyBase	E_val: 3.00E-162	ISS
GO:0006511	GO-bp	Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process	SoyBase	N/A	ISS
GO:0010043	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to zinc ion	SoyBase	N/A	ISS
GO:0051603	GO-bp	Annotation by Michelle Graham. GO Biological Process: proteolysis involved in cellular protein catabolic process	SoyBase	N/A	ISS
GO:0000502	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: proteasome complex	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0005839	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: proteasome core complex	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0019773	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: proteasome core complex, alpha-subunit complex	SoyBase	N/A	ISS
GO:0022626	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome	SoyBase	N/A	ISS
GO:0004175	GO-mf	Annotation by Michelle Graham. GO Molecular Function: endopeptidase activity	SoyBase	N/A	ISS
GO:0004298	GO-mf	Annotation by Michelle Graham. GO Molecular Function: threonine-type endopeptidase activity	SoyBase	N/A	ISS
GO:0008233	GO-mf	Annotation by Michelle Graham. GO Molecular Function: peptidase activity	SoyBase	N/A	ISS
KOG0181	KOG	20S proteasome, regulatory subunit alpha type PSMA2/PRE8	JGI		ISS
PTHR11599	Panther	PROTEASOME SUBUNIT ALPHA/BETA	JGI		ISS
PTHR11599:SF16	Panther	PROTEASOME BETA/DELTA SUBUNIT	JGI		ISS
PF00227	PFAM	Proteasome subunit	JGI		ISS
PF10584	PFAM	Proteasome subunit A N-terminal signature	JGI		ISS
UniRef100_I1MJB1	UniRef	Annotation by Michelle Graham. Best UniRef hit: Proteasome subunit alpha type n=1 Tax=Glycine max RepID=I1MJB1_SOYBN	SoyBase	E_val: 1.00E-170	ISS
UniRef100_I1MJB1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Proteasome subunit alpha type n=1 Tax=Glycine max RepID=I1MJB1_SOYBN	SoyBase	E_val: 1.00E-170	ISS

Expression Patterns of Glyma15g41330

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g41330 not represented in the dataset	Glyma15g41330 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma15g41330

Paralog	Evidence	Comments
Glyma08g17810	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma15g41330 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.15g260000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma15g41330

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma15g41330

Limit To All Plant Sequences

>Glyma15g41330.1   sequence type=CDS   gene model=Glyma15g41330   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGGGATAGTCAGTATTCGTTTTCTCTCACCACATTTAGCCCTTCTGGAAAGCTTGTTCAGATTGAGCATGCTTTGACGGCTGTTGGGTCTGGACAAACGTCTTTGGGAATTAAAGCTGCAAATGGAGTTGTCATTGCTACCGAGAAGAAATTACCATCTATATTGGTTGATGAAGCATCAGTCCAGAAAATTCAGTTATTAACACCAAATATAGGTGTCGTATATAGTGGCATGGGTCCCGATTTTCGAGTTTTGGTTCGAAAAAGCAGGAAACAAGCCGAGCAGTATCATCGGTTATATAAAGAACCAATTCCTGTCACTCAACTTGTCAGGGAAGTTGCCGCTGTAATGCAGGAATTTACTCAGTCTGGTGGTGTCAGGCCTTTTGGAGTGTCTCTGCTAGTTGCCGGGTTTGATGATAATGGGCCACAATTATATCAGGTGGATCCATCAGGTTCATATTTTTCTTGGAAAGCTTCTGCTATGGGGAAAAATGTTTCTAATGCAAAGACGTTTCTTGAGAAGAGGTACACAGATGATATGGAGCTTGATGATGCAGTCCACACAGCAATGTTGACTCTGAAGGAAGGGTTTGAGGGACAGATCTCAGGAAAAAACATTGAAATTGGCATAATTGGTGCTGATAAAAAGTTCAGGGTATTGACACCAGCTGAAATTGATGACTATTTGGCTGAAGTAGAATAA

Predicted protein sequences of Glyma15g41330

Limit To All Plant Sequences

>Glyma15g41330.1   sequence type=predicted peptide   gene model=Glyma15g41330   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGDSQYSFSLTTFSPSGKLVQIEHALTAVGSGQTSLGIKAANGVVIATEKKLPSILVDEASVQKIQLLTPNIGVVYSGMGPDFRVLVRKSRKQAEQYHRLYKEPIPVTQLVREVAAVMQEFTQSGGVRPFGVSLLVAGFDDNGPQLYQVDPSGSYFSWKASAMGKNVSNAKTFLEKRYTDDMELDDAVHTAMLTLKEGFEGQISGKNIEIGIIGADKKFRVLTPAEIDDYLAEVE*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain