Glyma15g41255 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g41255

Feature Type:	gene_model
Chromosome:	Gm15
Start:	48391367
stop:	48394423
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma15g41255

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G16490	AT	Annotation by Michelle Graham. TAIR10: myb domain protein 58 \| chr1:5629859-5630844 REVERSE LENGTH=274	SoyBase	E_val: 6.00E-75	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0009809	GO-bp	Annotation by Michelle Graham. GO Biological Process: lignin biosynthetic process	SoyBase	N/A	ISS
GO:0045893	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:2000652	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of secondary cell wall biogenesis	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
KOG0048	KOG	Transcription factor, Myb superfamily	JGI		ISS
PTHR10641	Panther	MYB-RELATED	JGI		ISS
PF00249	PFAM	Myb-like DNA-binding domain	JGI		ISS
UniRef100_D7KEF9	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: AtMYB58 n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7KEF9_ARALL	SoyBase	E_val: 9.00E-75	ISS
UniRef100_I1MJA7	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MJA7_SOYBN	SoyBase	E_val: 4.00E-111	ISS

Expression Patterns of Glyma15g41255

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g41255 not represented in the dataset	Glyma15g41255 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma15g41255

Paralog	Evidence	Comments
Glyma08g17861	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma15g41255 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma15g41255

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma15g41255

Limit To All Plant Sequences

>Glyma15g41255.1   sequence type=CDS   gene model=Glyma15g41255   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGGAAAGGAAGAGCACCATGCTGTGATAAGACTCAAGTGAAGAGAGGTCCTTGGAGCCCTGCAGAAGACCTTAAGCTCATAGCCTTCATCCAGAAATATGGCCACGAAAACTGGCGTGCTCTCCCAAAACAAGCAGGGCTCCTGCGATGTGGGAAAAGTTGTCGTTTGAGATGGATCAATTATCTAAGGCCTGATGTGAAGAGAGGCAATTTTACACCAGAGGAAGAGGAAACCATAATAAGGCTACACAAGGCCTTAGGAAACAAGTGGTCAAAGATTGCATCAGGTTTGCCTGGTAGGACTGACAATGAGATCAAGAATGTGTGGAACACCCACTTGAAGAAAAGATTGGCTCCAAAAAAAGTCTCAGAACAAGTGCTGATGAATCCAAGCCAGAATCATCAATCACTTCCTCCTCTTCCTCATCATCTGAATCATTTTTCTCCAATGAGAGACCAAATTCACCAAAGACCACCACACCTAGTAACAATGAATTCAATGACCAAGCTGAGAAATTATCAGTGGAAGATAAAATGGACAAGGATTCAGAAAAACAACTGTCCAACGAACTTGTTAACATCACTGAGGATCCAAAAGAGTCATCAGTTTCATTGTCTTCTGTTGAATCAAACATTGTAA

Predicted protein sequences of Glyma15g41255

Limit To All Plant Sequences

>Glyma15g41255.1   sequence type=predicted peptide   gene model=Glyma15g41255   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGKGRAPCCDKTQVKRGPWSPAEDLKLIAFIQKYGHENWRALPKQAGLLRCGKSCRLRWINYLRPDVKRGNFTPEEEETIIRLHKALGNKWSKIASGLPGRTDNEIKNVWNTHLKKRLAPKKVSEQVLMNPSQNHQSLPPLPHHLNHFSPMRDQIHQRPPHLVTMNSMTKLRNYQWKIKWTRIQKNNCPTNLLTSLRIQKSHQFHCLLLNQTL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain