Glyma15g41121 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g41121

Feature Type:	gene_model
Chromosome:	Gm15
Start:	48180234
stop:	48182066
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma15g41121

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G34245	AT	Annotation by Michelle Graham. TAIR10: Putative membrane lipoprotein \| chr1:12472990-12473631 FORWARD LENGTH=120	SoyBase	E_val: 2.00E-33	ISS
GO:0010052	GO-bp	Annotation by Michelle Graham. GO Biological Process: guard cell differentiation	SoyBase	N/A	ISS
GO:0010374	GO-bp	Annotation by Michelle Graham. GO Biological Process: stomatal complex development	SoyBase	N/A	ISS
GO:0048730	GO-bp	Annotation by Michelle Graham. GO Biological Process: epidermis morphogenesis	SoyBase	N/A	ISS
GO:2000122	GO-bp	Annotation by Michelle Graham. GO Biological Process: negative regulation of stomatal complex development	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
UniRef100_Q8LC53	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Protein EPIDERMAL PATTERNING FACTOR 2 n=1 Tax=Arabidopsis thaliana RepID=EPF2_ARATH	SoyBase	E_val: 1.00E-30	ISS
UniRef100_UPI000233BCFE	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233BCFE related cluster n=1 Tax=unknown RepID=UPI000233BCFE	SoyBase	E_val: 2.00E-78	ISS

Expression Patterns of Glyma15g41121

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g41121 not represented in the dataset	Glyma15g41121 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma15g41121

Paralog	Evidence	Comments
Glyma08g17890	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma15g41121 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.15g258600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma15g41121

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma15g41121

Limit To All Plant Sequences

>Glyma15g41121.1   sequence type=CDS   gene model=Glyma15g41121   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGCACTTTCTCCCTTGGAACTCCCAAATTTTTGCTAATTGTGGTTTTCTTCATGGTGGTTTCTATTAGTTGGAGCCTTAGAGTGATCCCAAATCATGCTAGTAAGTTGGCCAGCTTGCAAAAAGAGAAACCAACCATTAGAGATAAAAAGGAAGAAGTAAAGGAGGACAACATGGGAATGGAACTCTACCCAACTGGCTCCACCATACCAGATTGTTCCCATGCATGTGGACCATGCTCTCCCTGCAAGAGGGTGATGGTGAGTTTCAAGTGCTCCATTGCAGAGTCTTGCCCCATAGTTTATCGATGCACTTGCAAAGGGAAATACTACCATGTACCCTCCAATTGA

Predicted protein sequences of Glyma15g41121

Limit To All Plant Sequences

>Glyma15g41121.1   sequence type=predicted peptide   gene model=Glyma15g41121   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSTFSLGTPKFLLIVVFFMVVSISWSLRVIPNHASKLASLQKEKPTIRDKKEEVKEDNMGMELYPTGSTIPDCSHACGPCSPCKRVMVSFKCSIAESCPIVYRCTCKGKYYHVPSN*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain