|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT1G56340 | AT | Annotation by Michelle Graham. TAIR10: calreticulin 1a | chr1:21090022-21092630 REVERSE LENGTH=424 | SoyBase | E_val: 1.00E-18 | ISS |
GO:0006457 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein folding | SoyBase | N/A | ISS |
GO:0006979 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to oxidative stress | SoyBase | N/A | ISS |
GO:0009408 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to heat | SoyBase | N/A | ISS |
GO:0009627 | GO-bp | Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance | SoyBase | N/A | ISS |
GO:0009644 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to high light intensity | SoyBase | N/A | ISS |
GO:0009651 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to salt stress | SoyBase | N/A | ISS |
GO:0034976 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to endoplasmic reticulum stress | SoyBase | N/A | ISS |
GO:0042542 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to hydrogen peroxide | SoyBase | N/A | ISS |
GO:0046686 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to cadmium ion | SoyBase | N/A | ISS |
GO:0055074 | GO-bp | Annotation by Michelle Graham. GO Biological Process: calcium ion homeostasis | SoyBase | N/A | ISS |
GO:0005739 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion | SoyBase | N/A | ISS |
GO:0005774 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane | SoyBase | N/A | ISS |
GO:0005783 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum | SoyBase | N/A | ISS |
GO:0009506 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma | SoyBase | N/A | ISS |
GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
GO:0048046 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: apoplast | SoyBase | N/A | ISS |
GO:0005509 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: calcium ion binding | SoyBase | N/A | ISS |
GO:0051082 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: unfolded protein binding | SoyBase | N/A | ISS |
PTHR11073 | Panther | CALRETICULIN AND CALNEXIN | JGI | ISS | |
PTHR11073:SF2 | Panther | CALRETICULIN | JGI | ISS | |
PF00262 | PFAM | Calreticulin family | JGI | ISS | |
UniRef100_A0A762 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Calreticulin-1 n=1 Tax=Glycine max RepID=A0A762_SOYBN | SoyBase | E_val: 1.00E-19 | ISS |
UniRef100_C6TBV7 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6TBV7_SOYBN | SoyBase | E_val: 7.00E-20 | ISS |
Glyma15g41100 not represented in the dataset |
Glyma15g41100 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma15g41100.1 sequence type=CDS gene model=Glyma15g41100 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ACGGATGGGAAAATTGTTGAATTAAATCAGATTGGAAAAAAAGATGAGAACCTGACTGGGGAGTGGAACCACACCTCTGGTCAATGGAATGGAGATGCTAATGACAAAGGTATTCAGACCAGTGAGGATTACAGATTCTATGTTATTTCAGCTGAGTACCCTGAA
>Glyma15g41100.1 sequence type=predicted peptide gene model=Glyma15g41100 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high TDGKIVELNQIGKKDENLTGEWNHTSGQWNGDANDKGIQTSEDYRFYVISAEYPE
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||